SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000678 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000678
Domain Number 1 Region: 181-437
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.61e-78
Family Eukaryotic proteases 0.0000000916
Further Details:      
 
Domain Number 2 Region: 54-161
Classification Level Classification E-value
Superfamily Kringle-like 7.01e-17
Family Kringle modules 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000678   Gene: ENSMODG00000000564   Transcript: ENSMODT00000000693
Sequence length 443
Comment pep:novel chromosome:BROADO5:1:50657962:50667080:1 gene:ENSMODG00000000564 transcript:ENSMODT00000000693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLASLLLCVLVLGCRFSPSYCFHQPHLSFPGNCGCLNNGVCISYKYFSKIHRCSCPE
NFIGEHCEIGSSQVSDRGNSLTIWAFLRGWPTGFHGRSVLKWNADVLASKTYHANSDAVK
LGLGKHNYCRNPDNGKKPWCFVQIGRMQFKRECKVQQCSIGKGEGDIYGPLSSPTEKGGF
QCGYKSMTPRFKIVGGNTTPIENQPWFAAIYRNHLGGSSSFTCGGTLISSCWVVSAAHCF
PKIKRGENYVLYLGQSMRKSQTGGDSQFEVEQIILHENFSTGAIAYHNDIALLKIRSKTG
QCAEPSRVVQTICLPKAYEDVPSGSDCEVTGFGLENQNDYLYPEYLKMAVVNPISHKQCA
RPDYYGTEVTPKMLCAAHPEWKSDACQGDSGGPLVCPIDDRMVLVGVVSWGIDCAAENKP
GVYTRVSHFLPWIQAHTGLTGPI
Download sequence
Identical sequences F6X4X5
ENSMODP00000000678 ENSMODP00000000678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]