SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000694 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000694
Domain Number 1 Region: 18-115
Classification Level Classification E-value
Superfamily DEATH domain 1.6e-20
Family Caspase recruitment domain, CARD 0.011
Further Details:      
 
Domain Number 2 Region: 311-445
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000915
Family Tropomyosin 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000000694
Domain Number - Region: 903-963
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000611
Family Nucleotide and nucleoside kinases 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000694   Gene: ENSMODG00000000578   Transcript: ENSMODT00000000709
Sequence length 1022
Comment pep:novel chromosome:BROADO5:8:92369725:92415516:-1 gene:ENSMODG00000000578 transcript:ENSMODT00000000709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPPLAAEEEEDVGSEEEELWEKIEGVRHKLTRALNPAKLTPYLRQCRVIDEQDEEEVLS
TYGFPCRVNRTGRLMDILRCRGRRGYEAFLESLEFYYPEHFTLLTGREPAQRCSMILDEE
GPEGLTQFLMTEVRRLREQRKAQLQREQQLQAQTRALEEERATLERKLGEQLQAQERCQR
LREDWESGSLELLRLKEENYMIAMRLAQLSEEKNTAVLRSRDLQLMVDQLRCKVSRLEEE
CSMLRGQARSPAPSVQEAEEKEPEVPDLISELQAENQRLATSLRELQEGLKQVLSAHLEG
WPGSEQIILDILEHDWKEAQDDRQELCQKLHDVQGELQWAEQLRDKYLQEMEDLQLKHRT
LQKDCGLYKHRMATVLVQLEEIEKERDQAIQSRDHVQLQYSKSLVEKDQYRKQVRGLEAE
RDELLTTVTRLEGAKGLLEAQLQRAQGCVGMKACNSSHSLCSNVSSTWSLSECPSLLGGP
DMTGETTTSGGSEPRALGGGTSWTWEKGAPGLILALQSGASVSPSENTTNPSPSQRTVIG
ECLYTPESFGRGRCSDSPGLWGKAGGAPEPGLEASDSAFDILLSFFPFRSLAIRGPSRQS
PPGGPEPQEKGTDSTSFLGNSHPGVVLRRALSGPGTESTMEVREGHQFLEVRRDNPSPEN
GQAQLSTLHWNEATTFTFFQDMKVCPSPREYSDSTCKKGSSGAGSFYVRANYPLPEQADP
RALCVKGQEILRVVDPAYKGRPEWYCARVDPLTLRDLDRGTVPNFRRAQQLLEAQDKYPH
YGRSRNHRSNLKKRALDQLRLVKPRLSGGPGDPQEQLLLDPCPDPDRNAKPYSLVRPLLV
SSLRPVVLSPECLASRLIRNLLDLPSSRLDFHVCPAESLTGEEQLVPAAPGAPSARPVPQ
GLGVRIRTIQESIGKNKHCLLELSPQSVRELVRSEIYPIVIHVDVTEKNVREIRSLLGRP
GWRDSELLRQCRGLEHLLWDLPCSWARVDTHAWAHAEELAKVVRGRILQEQARTVWVECG
EI
Download sequence
Identical sequences F6X3J9
ENSMODP00000000694 ENSMODP00000000694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]