SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000728 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000728
Domain Number 1 Region: 266-352,558-595
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.7e-40
Family Inhibitor of apoptosis (IAP) repeat 0.00000472
Further Details:      
 
Domain Number 2 Region: 178-265
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 6.8e-32
Family Inhibitor of apoptosis (IAP) repeat 0.0000879
Further Details:      
 
Domain Number 3 Region: 41-129
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 4.97e-29
Family Inhibitor of apoptosis (IAP) repeat 0.00042
Further Details:      
 
Domain Number 4 Region: 455-553
Classification Level Classification E-value
Superfamily DEATH domain 2.03e-23
Family Caspase recruitment domain, CARD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000728   Gene: ENSMODG00000000608   Transcript: ENSMODT00000000744
Sequence length 620
Comment pep:novel chromosome:BROADO5:4:258776822:258809483:1 gene:ENSMODG00000000608 transcript:ENSMODT00000000744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
THKTTSQRKTCPLLFPKYSIMSVVEDGVLLSHLMSSDTHEMKYDLSCELYRMSTYSAFPV
NVPISERSLARAGFYYTGVNDRVKCFCCGLMLDNWKQGDNAIDKHKQLYPSCAFIQNLIS
VNLGSSQSTFSSSVNNATRSLSLSSEQSGYFSGSYSSFPLEPVTSRGVEDLSPLNTSPYS
YSMSTEEARILTYQAWPLTFLSPLDLARAGFYYIGPGDMVACFACGGKLSNWEPKDDAMS
EHRRHFPHCPFLESQIQETSRFNVSNLSMQTHAARVKTFVTWPPQIPVHPEQLANAGFYY
VGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRQYLIRMKGQEFVDQVQARYPHLLEQ
LLSTSDIPGDENAELPIIHFGPGENNSEDTVMMNTPVIKAALEMGFSRSLVKQIVQSKIL
TTGENYKTVNEVVSDLLNAEDEKRKEEKERQTEEMASDDLTLIRKNRMALFQHLTCVLPI
LDSLLTSGVINEQEHDVIKQKTQTSLQARELIDTILVKGNAAASVFKNCLREIGSVLYNN
LFVEKNMKYIPTEDVSGLPMEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKECAPS
LRKCPICRGIIKGTVRTFLS
Download sequence
Identical sequences F6TB82
ENSMODP00000000728 ENSMODP00000000728 13616.ENSMODP00000000728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]