SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000814 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000814
Domain Number 1 Region: 957-1171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.43e-105
Family Thrombospondin C-terminal domain 0.00000000149
Further Details:      
 
Domain Number 2 Region: 29-233
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.45e-39
Family Laminin G-like module 0.000000022
Further Details:      
 
Domain Number 3 Region: 834-955
Classification Level Classification E-value
Superfamily TSP type-3 repeat 6.8e-37
Family TSP type-3 repeat 0.000000146
Further Details:      
 
Domain Number 4 Region: 491-548
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 2.88e-16
Family TSP-1 type 1 repeat 0.0000203
Further Details:      
 
Domain Number 5 Region: 437-487
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000209
Family TSP-1 type 1 repeat 0.0000421
Further Details:      
 
Domain Number 6 Region: 763-836
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000222
Family TSP type-3 repeat 0.00022
Further Details:      
 
Domain Number 7 Region: 318-376
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000241
Family VWC domain 0.0037
Further Details:      
 
Domain Number 8 Region: 693-777
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000051
Family TSP type-3 repeat 0.00014
Further Details:      
 
Domain Number 9 Region: 381-430
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000122
Family TSP-1 type 1 repeat 0.00077
Further Details:      
 
Domain Number 10 Region: 549-603
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000203
Family EGF-type module 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000814   Gene: ENSMODG00000000679   Transcript: ENSMODT00000000832
Sequence length 1172
Comment pep:novel chromosome:BROADO5:1:195708620:195726898:1 gene:ENSMODG00000000679 transcript:ENSMODT00000000832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLAWGLVLLLLLKVCGTNRISESGGDNSVFDLFDLPGAAHKGSGRRLVKGPDSSSPAYR
IEDANRIPAMPADKFQDLVDAIRAERGFIFLASLRQMKKTRGTLLTVEYKDHSGHIFSLV
SNGKAGTLDLSISVQGKQQVVSVEEALLATGQWKSILLFVQEDRAQLYVGCEKMENAELD
APIESIFTRDLAGKARLRVAKGDVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTNHII
TLDNPVNGSSPAIRTNYIGHKTKDLQAICGFSCDELANMFLELKGLRTIVTTLQDNIRKV
TEENELLSIAVQKPWSDPGCSYNGIKYNNNDMWTIDSCTECYCQNSVTMCKKVSCPLMPC
SNATIPDGECCPRCWPSDSADDSWSPWSEWTSCSVTCGNGIQQRGRSCDSLNNRCEGSSV
QTRTCHIRECDKRFKQDGGWSHWSPWSSCSVTCGSGEITRIRLCNSPSPQMNGKPCEGEA
RETKACQRDACPINGGWGPWSPWDICSVTCGGGLQKRSRLCNNPKPQFGGKDCVGDATGS
QLCNKQDCPIDGCLSNPCFAGAKCTSYADGSWTCGACPAGYTGNGIQCKDVDECQEVPDA
CFNHNGVHRCENTDPGYNCLPCPPRFTGSQPFGRGVEHATANKQVCKPRNPCTDGTHDCN
KNAKCNYLGHYSDPMFRCECKPGYAGNGIICGEDTDLDGWPNEDLVCVANATYHCKKDNC
PNLPNSGQEDYDKDGIGDACDNDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCP
YNHNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPL
EHNPDQLDSDSDRIGDTCDNNQDIDEDGHQNNMDNCPYVPNANQADHDKDGKGDACDHDD
DNDGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENVAISETDFR
RFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAIGFDEFNAVDFSGTFFINTER
DDDYAGFVFGYQSSSRFYVVMWKQLTQSYWDSSPTIAQGYAGLSVKVVNSTTGPGEHLRN
ALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPI
YDKTYAGGRLGMFVFSQEMVFFSDLKYECRDS
Download sequence
Identical sequences F6WMA0
ENSMODP00000000814 XP_001380945.1.35504 ENSMODP00000000814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]