SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000863 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000863
Domain Number 1 Region: 114-347
Classification Level Classification E-value
Superfamily ClpP/crotonase 8.36e-59
Family Biotin dependent carboxylase carboxyltransferase domain 0.0000604
Further Details:      
 
Domain Number 2 Region: 317-592
Classification Level Classification E-value
Superfamily ClpP/crotonase 7.82e-45
Family Biotin dependent carboxylase carboxyltransferase domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000863   Gene: ENSMODG00000000721   Transcript: ENSMODT00000000881
Sequence length 612
Comment pep:novel chromosome:BROADO5:2:22905191:22965728:-1 gene:ENSMODG00000000721 transcript:ENSMODT00000000881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTCILMRKAFFNANMHLFPRLAGAPTYSLKSQMQNKISFTKKVQILCSPPQVRGISDFI
QDGALPSSGAKSRKSKNSWSFPVLDGTIKMEQMDRTEANLRNSEACIQRYLELLGESHQR
EERDIIRHTQRHGKLLVRERLRLVLDDDDFFELSPLAGYDLPYGTISNAGCLTGIGKVCG
IWCMLIANDATVKGGTMYPITVKKHLRAQAIATMNRLPTVYLVDSGGAFLPLQAEIFPDS
CHGGRIFYNIAVMSSMKIPQVAVVCGSCIAGATYIPSIADESIIIDKIGSMFIAGPPLVK
AATGENISVEELGGATLHSRISGGIDYVTSTEEEAYERTRHIVMTLKCEEPSKEPVGYDD
PLYSPEELKALAPQNYECSLDVKLILSRLIDGSRFQEFKAEYGTTLVTGFAHVKGHLVGL
VASNGELSYQASLKGSHFVRLCRHRNVPLLFLLNTVPQTSACTSPAQAEDLGRRCKAQAC
MMATIACAEVPKITLVIGGNFGNDSYAMCGRSFDPNFLFLWPNARVALVDYRSLTTDFLE
GDEHFSMDKSTRKNLGKKLEKESSAFYSSARLWDDGVILPQRSREVIARCLEIIKQKEGQ
IFSHQQQPILRF
Download sequence
Identical sequences F6W6I4
XP_016285333.1.35504 ENSMODP00000000863 ENSMODP00000000863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]