SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000881 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000881
Domain Number 1 Region: 303-469,525-678
Classification Level Classification E-value
Superfamily L domain-like 1.07e-46
Family Ngr ectodomain-like 0.00019
Further Details:      
 
Domain Number 2 Region: 75-281
Classification Level Classification E-value
Superfamily L domain-like 6.8e-42
Family Ngr ectodomain-like 0.00024
Further Details:      
 
Domain Number 3 Region: 956-1145
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-40
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 884-925
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000431
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 5 Region: 718-759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000533
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 6 Region: 761-805
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000901
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 7 Region: 849-887
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000545
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 8 Region: 798-833
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000368
Family EGF-type module 0.012
Further Details:      
 
Domain Number 9 Region: 1-44
Classification Level Classification E-value
Superfamily L domain-like 0.00000437
Family Ngr ectodomain-like 0.0072
Further Details:      
 
Domain Number 10 Region: 1141-1182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000142
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000000881
Domain Number - Region: 1231-1260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000115
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 1184-1220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000608
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000881   Gene: ENSMODG00000000731   Transcript: ENSMODT00000000899
Sequence length 1341
Comment pep:novel chromosome:BROADO5:5:208174468:208353876:-1 gene:ENSMODG00000000731 transcript:ENSMODT00000000899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGLYTQCMGPSHLKGHNVAEVQKREFVC
SGHQSFMTPSCSVLHCPAACTCSNNIVDCRGKGLPEIPTNLPETITEIRLEQNSIKVIPP
GAFSSYKKLRRIDLSNNQISEIAPDAFHGLRSLNSLVLYGNKITELPKSLFEGLFSLQLL
LLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTLHLAQNPFICDCH
LKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYRSKLS
GDCFADLACPEKCRCEGTTVDCSNQKLNKIPDHIPQYTAELRLNNNEFTVLEATGIFKKL
PQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVRHKMFKGLESLKTLMLRSNR
ITCVGNDSFIGLSSVRLLSLYDNQITTIAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGD
WLRKKRIVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSCSPLSRCPAECTCLDTV
VRCSNKGLKALPKGIPKDVTELYLDGNQFTLVPKELSNYKHLTLIDLSNNRISTLSNQSF
SNMTQLLTLILSYNRLRCIPARTFDGLKSLRLLSLHGNDISVVPEGAFNDLSSLSHLAIG
ANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGPVDVNILA
KCSPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCDVPIHSCISNPCKHGGTCHLKEG
EKDGFWCTCADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTCLCPPEYTAANLNEVE
KGELCEEKLDFCAQDLNPCQHDSKCILTPKGYKCDCTPGYVGEHCDIDYDDCQDNKCKNG
AHCTDAVNGYTCICPEGYSGLFCEFSPPMVLPRTSPCDNFECQNGAQCIIKINEPICQCL
SGYQGEKCEKLVSVNFVNKESYLQIPSAKVQPQTNITLQIATDEDSGILLYKGDKDHIAV
ELYRGRVRASYDTGSYPASAIYSVETINDGNFHIVELIAMGQSLSLSIDGGSPKTITNLS
KQSTLNFDSPLYVGGMPGKNNIAALRQAPGQNGTSFHGCIRHLYINSELQDFRKVPMQTG
ILPGCEPCHKKVCAHGTCQASSQSGFTCDCEEGWMGPLCDQRTNDPCLGNKCMHGTCLPI
NAFSYSCKCLEGHGGVLCDEEEELFNPCQSIRCKHGKCRLSGLKQAYCECNSGYTGESCD
REVSCRGERIRDYYQKQQGYAACQTTKKVSRLECKGSCASGQCCGPLRSKRRKYSFECTD
GSSFVDEVEKVVKCGCTRCPS
Download sequence
Identical sequences F6W5I6
ENSMODP00000000881 ENSMODP00000000881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]