SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000985 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000985
Domain Number 1 Region: 34-505
Classification Level Classification E-value
Superfamily Cytochrome P450 1.57e-121
Family Cytochrome P450 0.0000000000065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000985   Gene: ENSMODG00000000829   Transcript: ENSMODT00000001004
Sequence length 510
Comment pep:novel chromosome:BROADO5:6:80783378:80814644:-1 gene:ENSMODG00000000829 transcript:ENSMODT00000001004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIIPSLSAGTWTLIVVFLTLLYLYGTRTHKLFKNLGIPGPKPLPFFGTVFSYRKGLVNF
DYDCFKKYGKTWGFYDGRQPVLATMDPETIKTVMVKECYSVFTNRRSFGPVGSLESAITV
AKDDQWKRIRTVLSPTFTSGKLKEMFPIINQYGDVLVKNMKKEAEKNKPVTMKDILGAYS
MDVITSTSFGIHVDSLNNPNDPFVREIKKLIRFNFLDPLILSVAIFPFLTPLFNKLDITV
FPKDAINFLAKSLISMFSTIFSALVFILHYFFQHRVDLLQLMMDSQSSKNSEPHSHKDLS
DQEILAQSIIFLFAGYETTSSVLSFLFYHLATNPEIQEKLHKEIDAVLPNKEAVTYDALV
QMEYLDMVINENLRLFPIAGRVERVAKKTVELNGLTIPKGTVVMTPPYVLHREPEYWPEP
EKFHPERFSKENKESINPYVYLPFGAGPRNCIGMRFALMNMKVAVSRLLQEFSFRTCKET
QVPLKLGNQPILTPTIPIVLQAELRNKKTN
Download sequence
Identical sequences F6S8U2
13616.ENSMODP00000000985 ENSMODP00000000985 ENSMODP00000000985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]