SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001016 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001016
Domain Number 1 Region: 177-219,345-514
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.54e-43
Family Tandem AAA-ATPase domain 0.0022
Further Details:      
 
Domain Number 2 Region: 49-283
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1e-41
Family Tandem AAA-ATPase domain 0.0012
Further Details:      
 
Domain Number 3 Region: 658-683
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000000647
Family Ran binding protein zinc finger-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001016   Gene: ENSMODG00000000848   Transcript: ENSMODT00000001035
Sequence length 1118
Comment pep:novel chromosome:BROADO5:4:132323850:132517887:-1 gene:ENSMODG00000000848 transcript:ENSMODT00000001035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTKVSFSSPSEGNPGMTSLHQASMLNMYNISNTQEPYTPKDSCLKTEFEDQLLFLPKKL
RARLLPFQKNGIKFALKRDGRCMVADEMGLGKTIQAVAIAYFYKNEWPLLIVVPSSLRYP
WTEEIEKWIPELGPQEIVIIQNKTDIGSISTSKVTVLGYGLLTTDAKLLIDTLYNQNFKV
VIIDESHYMKSRNASRSKILLPIIQNSRRAILLTGTPALGRPEELFMQIDALYPKRFGTW
TEYAKRYCNAHLRYFGKRAQWDCRGASNLGELHQLLSNIMIRRLKNEVLTQLPPKIRQRI
PFDLPSTAAKELNTSFEEWEKLMRAPHSDANKTGSHFFQVMGLMTRMFKQTAIAKAGAVK
DYIKLMLQNDLLKFLVFAHHLSMLQACTEAAIESKVRYIRIDGSVPSSERIHLVNQFQKD
PDTRVAILSIQAAGQGLTFTAATHVIFAELYWDPGHIKQAEDRAHRIGQSSSVNIHYLIA
NGTLDSLMWGMLNRKAIVTGSTLNGRKEKLEAEEGDKEKWDFLKFAEAWTPNENFEEIKN
EVLFTHFEKEKQHDIRSFFSPKHKEKKHTIASCDESRVRQEKATEKALDCRNIAKRDAID
YESDFEPEAKKWKSVVIQSNSSQKEKRSTWSSSTKAEFIKETVQEKKSNSIKISLLGKDW
QCGLCTYVNSSLLTYCEMCETPQDSTAYLNKKQIDDHNWIQVEKGNQVNESQKDTILQIE
TNSSCGQQILEQSVTEQFMESKEEKAESENEDERDGLKPQQEQLKNSDTLPVYDVLMFCA
SKNTDRIHLYTKDGEQMNCNFIPLDIKLDLWEDLPACFQLKQNRSLILKFVREWSSLTAM
KQRIIRRSGHIFCSPILALDEITMQQIKQCSIKRYITKEDVAAAAVNKVQRDGGSTRVIT
KESKFLSKKQISSAVETQEMPVNPDQGDLTIQPSTSKGFLQAIDTEGNPLCLHCQQPTCQ
SDQQDKVNAWDSRFCSQKCQEEFWIRSNNSYLRAKVFEIEHGVCQLCHLNAQELFLSLRD
APKHQRKNLLQATWISKLSIEQLNEMMKNPVEGQFWQVDHIRPVYSGGGQCSLENLQTLC
TVCHKERTAKQAKERSLAKRKSFASKYGSDITRFFTKK
Download sequence
Identical sequences F7BI83
XP_007494153.2.35504 ENSMODP00000001016 ENSMODP00000001016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]