SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001037 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001037
Domain Number 1 Region: 2-188
Classification Level Classification E-value
Superfamily vWA-like 1.06e-54
Family Integrin A (or I) domain 0.0002
Further Details:      
 
Domain Number 2 Region: 245-405
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-30
Family Laminin G-like module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001037   Gene: ENSMODG00000000871   Transcript: ENSMODT00000001057
Sequence length 1595
Comment pep:novel chromosome:BROADO5:3:420323023:420822133:-1 gene:ENSMODG00000000871 transcript:ENSMODT00000001057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCKNVHYDLVFILDTSSSVGKDDFEKVRQWVANLVETFEIGPDRTRVGVVRYSDRTTTEF
DLGKYWTREEVKAAARNINYHGGNTNTGDLRYITTYSFSKEAGGRPSDRAIKKVAILLTD
GRSQDIVLDAARAAHKAGIRVFAVGVGEALKEELDEIASEPKSAHVFHVSDFNAIDKIRG
KLRRRLCENVLCPSVRVEGDRFKHTNGGTNEITGFDLMDLFSVKDILGKKEGGAQSSYVR
MGSFPVVQRTEDVFPQGLPDEYAFVTTFRFRKTSRREDWYIWQVIDKYGIPQVSIRLDGE
NKAVEYNAVGVMKDAVRVVFRGVPVSDLFDRNWHKIALSIQAKNVSLYIDCKLVQTLPIE
ERENIDIQGKTVIGKRLYDSVPIDFDLQRIVIYCDSRHAELETCCDIPSGPCQVTVITEA
PLPETPPTIGSEQIGFLKTINCSCPAGEKGERGIEGPQGLKGEIGVPGYSGLPGPKGEKG
DSGQGTFFKGEKGEKGSIGLSGPPGREGAKGIRGEPGEIGEPGLPGEVGLKGPMGPPGQP
GLPGQIGIPGLQGERGERGPRGDKGERGLDGFPGKPGEEGKKGSPGAPGMAGIQGEKGEV
GPSGPPGIPGSVVQKEGLKGEQGAPGPRGHQGLPGPPGSPGPMGPEGKEGLPGSQGQRGK
KGEAGLPGVNGLPGPPGSQGSPGVRGPPGPAGPPGKRFLGKEKNSGRWSPRGSPGKDGTN
GLPGLQGPKGETGERGEGGLPGNPGPRGEAGEQGLVGIPGEKGEMGLPGSPGFQGLRGEK
GDEGKKGGLGLPGLKGDRGEKGEAGPAGPPGPPGFPGTASVFANHCIAEGEAGQKGEKGD
PGIGGEPGPRGFQGEVGPRGPPGPPGAQGPEGARGGPGAAGNTGVPGPIGPPGARGLPGN
VGIPGVMGPPGKIGERGEKGEPGEEGKTGPLGPRGDPGPPGEPGPPGKGKEGESGRPGAP
GLPGPQGHKASCYSRKSNNISVQRRMIKGDRGAPGLPGQPGNRGGPGIGVAGPPGSTGPP
GEKGPPGSRGLPGFPGPQGPAGQDGLPGNPGERGPQGKPGPSPLLSPEDLNLLVKDVCND
CPPGPPGLPGLPGLKGDKGLQGKPGRDGADGKKGDAGLKGLPGSPGIIGPKGNKGEPGAD
GEIGQKGEQGHPGVPGFMGPAGDPGPPGAVGASGPAGPPGSPGMTGKDGPPGPQGPPGLP
GIPGEEGKEGKDGKPGAPGEPGPSGEPGLPGQDGARGPPGFKGHTGDSGPPGPRGEAGAP
GPEGREGSPGKDGDTGPTGPPGLRGLRGAPGKNGSPGSPGDPGQPGNPGQKGNKGDNGSP
GLPGFQGPRGPPGEQGEKGIPGKEASTQHGAPGKPGEQGTKGERGDPGVKGDKGTQGQKG
QPGEPGLPGHKGHTGLMGPHGPPGESGPAGPPGPPGQPGFPGARGDSPSVDTLRRLIQEE
LGKQLETKLAYLLAQMPPAHVRATQGRPGPPGPPGKDGLPGRVGPMGEPGRPGQVGLEGP
SGPMGPKGERGPKGDQGQPGVGQRGEIGPPGIPGQPGEPGYGKDGIPGIPGPQGEAGQAG
LPGPPGPPGPSGQCDPSQCAYFASLAARPGNVKGP
Download sequence
Identical sequences F7AVL9
ENSMODP00000001037 ENSMODP00000001037 13616.ENSMODP00000001037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]