SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001087 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001087
Domain Number 1 Region: 101-146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000261
Family EGF-type module 0.019
Further Details:      
 
Domain Number 2 Region: 58-116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000399
Family EGF-type module 0.036
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000001087
Domain Number - Region: 20-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0619
Family EGF-like domain of nidogen-1 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001087   Gene: ENSMODG00000000912   Transcript: ENSMODT00000001109
Sequence length 746
Comment pep:novel chromosome:BROADO5:2:51517576:51657496:1 gene:ENSMODG00000000912 transcript:ENSMODT00000001109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLILLLVCLSTLLDGTFAQNCAKTQCHPHAKCEIRNGIEGCYCVSGFTGNGITICKDDN
ECENSTQPCGENANCTNTEGGYFCMCAPGFTSSSSQNKFVTNDGTTCIDIDECREANSGA
CGDRAKCENVNGGYHCACKEGYQPSTGKLQFKPDDGTYCQENVKANCHLDDVCIAANINK
TLIEIKHQKELRNLLQEIYQNSEQVLFPIDVLTNVEALSASSSSLSYMNSNVSEKEAFIN
TTINVFVNTINNLVQKDKITVWDKLSADNRRTSLTKLMHTAEQTMLSMSQNFKKTTQLEI
NSSDMGLKLFAFDSHHMKHIHPHMNMEGNHIKIYPKRKDEYDSNGRKTVYFLWCFCDYKS
IGALLLSPESASQETESHESPEQEEIVISSVVSVSISAKPMALYQLEKITFTLSHVKPRE
KSSIKCAFWNYSSDTLNGSWSTEGCELMHSNSTHTSCKCNHLTHFAILMSSGVSIGIKDY
NILTRITQLGIIISLVCLAMCIFTFWFFSEIQSTRTTIHKNLCCSLFLAELVFLVGINTN
SNKLFCSIIAGLLHYFFLAAFAWMCIEGIHLYLIVVGVIYNKGDLHKNFYIFGYLSPAVV
VGFSASPRYRYYGTTKVCWLSTENNFIWSFIGPACLIILVNLLAFGVIIYKVFRHTAMLK
PEVSCYENIRSCARGALALLFLLGTTWIFGVLHVVHASVVTAYLFTISNAFQGMFIFIFL
CVLSRKIQEEYYRLFKNVPCCSGCLR
Download sequence
Identical sequences F6ZHD1
ENSMODP00000001087 ENSMODP00000001087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]