SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001131 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001131
Domain Number 1 Region: 20-213
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.86e-61
Family Calnexin/calreticulin 0.00012
Further Details:      
 
Domain Number 2 Region: 198-312
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 1.57e-40
Family P-domain of calnexin/calreticulin 0.00000465
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000001131
Domain Number - Region: 304-345
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0839
Family Calnexin/calreticulin 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001131   Gene: ENSMODG00000000946   Transcript: ENSMODT00000001154
Sequence length 350
Comment pep:novel chromosome:BROADO5:2:3653398:3679421:1 gene:ENSMODG00000000946 transcript:ENSMODT00000001154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISYPPNTFCIISSLRECKPFVFFLSPTDGWKKRWVQSKYQSDYGKFKLTAGMFYGNKEKD
KGIQTTEDAKFYALSARFKPFSNEGQSLVVQFSVKHEQGIDCGGGYIKLFPEDLDQENMN
SNSTYYIMFGPDICGMGNNKVHVILNYKGKNHENNKTIKCRINKDTHLYTLILRPDSTYG
VKIDNELVAVGALEDDWDFLPPKKIKDPYARKPRKWDERPQIEDPDDKKPEDWQDFAQIP
DPDAKKPDDWDEGMDGKWEPPLIPNLKYKGEWKPRIIDNPDYKGEWVHPEIDNPKYKADP
NIYRYYNISVLGLDIWQVKSGSIFDNFLLTNDEEFAEKVGNQTWGVRKVS
Download sequence
Identical sequences F7F7P9
ENSMODP00000001131 13616.ENSMODP00000001131 ENSMODP00000001131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]