SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001196 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001196
Domain Number 1 Region: 1342-1451
Classification Level Classification E-value
Superfamily PDZ domain-like 7.1e-34
Family PDZ domain 0.00000649
Further Details:      
 
Domain Number 2 Region: 1761-1935
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.58e-28
Family Nucleotide and nucleoside kinases 0.00017
Further Details:      
 
Domain Number 3 Region: 585-697
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-18
Family PDZ domain 0.0017
Further Details:      
 
Domain Number 4 Region: 1508-1604
Classification Level Classification E-value
Superfamily PDZ domain-like 1.06e-16
Family PDZ domain 0.0057
Further Details:      
 
Domain Number 5 Region: 1612-1686
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000341
Family SH3-domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000001196
Domain Number - Region: 1-97
Classification Level Classification E-value
Superfamily DEATH domain 0.000141
Family Caspase recruitment domain, CARD 0.019
Further Details:      
 
Domain Number - Region: 739-786
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00469
Family PDZ domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001196   Gene: ENSMODG00000001002   Transcript: ENSMODT00000001221
Sequence length 1938
Comment pep:novel chromosome:BROADO5:1:55149386:55305586:-1 gene:ENSMODG00000001002 transcript:ENSMODT00000001221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPKHRELLAHCQQSLAQAMTEVEAVLGLLEAAGALSPGDPRQLEEETPATGGAGGPGVK
GELLLKLLLFKDGDHFQDLGVALEKTQPHLFPILYLKGVAGAPHPSEGPGTTGKASSPPP
PSSDSRQANEKVESLLVQLRLITRERDELRKRLALSSPGSTFDDCRPYHKLNPDYERLKI
QCMRAMSDLQSLQNQHTKTLKRCEEVAKEADFYHTLHNRLLSDQAQLKEDVDALRRENGQ
LLRERNHLQQSCEDMKRLREEDQKEITDLRAQQQQVLKENGSSEILNTLYDTAMGKLEGL
KKDYDGLRKRYNEKVANHNTDLSRLEQMEEENRRLQKQTDTLVKQRDTSIHFQQQYSLSL
RRFESMQQDLNKATVQNKELQREMERLQSEVTRLRSMQLKALKDAEKYKEERDSVFNEYQ
LIMSERDQVIKELDKLQTELELAESKLKNTTSEKRVASEEMEALRQIQDSATLDIERANK
EIEMLRKQYEAMSQELKEAIQEAEVAKCRRDWAFQERDKIVAERESIRTLCDNLRRERDR
AVSDLAEALRNLDDMRKQKNDAGRELKELKEKMENQLEKEARFRQLMAHSSHDSAIDTDS
MEWETEIVEFEKDREDMDLKALGFDVAEGVNEPYLPGDCGIFVTKVDKGSIADGRLRVND
WLLRINDVDLTNKDKKQVVKAVLSGGGVINMVVRRRKSLGGKVITPLHINLAGHKGNRPG
APGDTFSGYFWRLAHYIGDMAFEARSLSLGSFWTSINGIALDNKSLTECESLLRNCRDSL
TLSLMKVFPQSSSWSGQNIFENLKDSEKVLNCRLHGSEVQAQNKRNLTQHNSSTQTDIFH
LESLEDKKDPSTPGSSGGSFCEHKPFPRGPLQVVDPHRSCHSTSEHSLSSFSSDPYGERG
YGLVNLGSRRMLPPFDTVIGDCVLVGSTLEEAGSGMKHSGGTWPKVMVNASSAETEKFSV
YKKPKQRKSIFDPDTFKRPQTPPKVDYLSPGPAPAHSPQSSKAEGSPTPPTPPKRSDSIK
FKHRPQDSSGSETTLVPSSPSTSPPASHPSAPAPLGLKQDSPPHKSRGRIPGHYYREEDG
DCALLPGRKPCEEDGSFQRGDDADLKRPRPKSAPILRHKLTPVTIPNQTLQAQKYTPTPD
EHFTPELQEWIPYSPKRSSRHSDGFVPIYSGGVSAGTVPRNLAPCPAVTAIMRNPIYTAW
SHRVHPNSCQSAAGQMHHQHLHPSAQHQGRLSLDLSHKHSSDYSDTSRTRTSHGSNSLPS
SARLGSSSNLQFRTERIKIPLTPRYPRSVMGSDRGSLSHSECSSPSLITPPQSPLNLETS
SFASSQSQSSLSTLPRIAISPASIGERRKDRPYMEEPRHVKVQKGSEPLGISIVSGENGG
IFVSKVTGGSIAHQAGLEYGDQLLEFNGINLRNATEQQARLIIGQQCDTITILAQYNPHM
YQLGNHSRSSSRLDPVSTHSNPQGSGTATPDSHSIIDTVSEQDEGTITPTSKQTTPTTSP
RNSIRVLADSNKRPPEARVVIIKKTQVELGVQICGGNLHGVFVADVEDDSPASGPDGLVP
GDLILEYGSVDMRDKTAEEAYLEMLKPGENIRVKVQYRLEDFNKVKDVPGDGFYIRALYD
RLAEVDQELSFKKDDILYIDDTLPQGTFGCWMAWQLDENAQKLERGQIPSKYIMDQEVSR
RHSMSEVKDENSSSKTLSAAARRSFFRRKQKHKRNGSKDSKDLLALDTISTDSIPFLEGK
YSVSLAYQRVQKVDCTSPRPVLILGPLLDAVKDMLVKEAPGKFCRCPLEVMKASQQAIER
GVKDCLFIDYKRRSGHFDVTTVASIKEITDKDCHCLLDIGPHAIERLHSIHIYPIVIFIR
YKNAKQIKEQRDPIFLRDKVTQRHSKEQFETAQKIEQEYSKYFTGIVQGGALANICTQIL
TTVDEEQNKVLWIPACPL
Download sequence
Identical sequences F7E9J4
ENSMODP00000001196 ENSMODP00000001196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]