SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001247 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001247
Domain Number 1 Region: 100-285
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-48
Family SPRY domain 0.0000576
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001247   Gene: ENSMODG00000001053   Transcript: ENSMODT00000001273
Sequence length 287
Comment pep:novel chromosome:BROADO5:3:441623434:441624294:1 gene:ENSMODG00000001053 transcript:ENSMODT00000001273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNYSRMYAFLRRKEEQHLLRLGKKKQKNLEKFKENKWKLSEQVQDLQTMAIKLDINNAEK
LDFNMIQDAKDMLNKSKALLLQYPKLNLPKWTMCYITGLREMKMTYQRDIKLDPETANSH
LIVSSELKSIKYSLVPQDVPDNPERFNFSATVLSIQSFTSGIHYWEVETGDMIQWEVEIC
KNSINRKGNSPPIPGEVISLKAFKEREKFCLSVTHIEANFQIKKPIQRIDPFLDYENGHI
SFYNVTDGLLICSMSVIAFKGPFRSFFSPCFQNKGSPSKSLVICPME
Download sequence
Identical sequences F6YRR6
ENSMODP00000001247 ENSMODP00000001247 13616.ENSMODP00000001247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]