SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001267 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001267
Domain Number 1 Region: 23-263,331-377
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.21e-99
Family Type II chitinase 0.00000000546
Further Details:      
 
Domain Number 2 Region: 259-326
Classification Level Classification E-value
Superfamily Chitinase insertion domain 3.82e-21
Family Chitinase insertion domain 0.0000587
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001267   Gene: ENSMODG00000001065   Transcript: ENSMODT00000001294
Sequence length 380
Comment pep:novel chromosome:BROADO5:2:107458261:107472155:-1 gene:ENSMODG00000001065 transcript:ENSMODT00000001294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLKAAEIGFSILVLFQYSYAYKLVCYYTSWSQYRDGDAKCLPDNIDANLCTHVIYSFAN
ISNNQIDTWEWNDVTLYETLNELKQRNTKLKTLLSVGGWNIGTKRFSDMASQTESRQTFI
NSVTEFLRTYDFDGLDLAWLYPGRRDRENYSLLLQEMADEFSKEAQRTGKERLLLSAALS
AGRVAIDAGYNLPQISEHLDFINLLTYNFIGNWQKTTGHHSPLYKGRKDNNYSNVRYAVD
YILLKKVPANKLVMGIPTFGNSFTLASSDSEVGAAILGPGTAGLYTKEPGTLAYYEVCEF
LPGATVKRIVEQKVPYATKGNQWVGYEDQESVKTKVQFLKSRQLAGAMVWALDLDDFQGT
FCNQKPYPLTGAIKEALFST
Download sequence
Identical sequences F6YQY7
XP_016285570.1.35504 ENSMODP00000001267 ENSMODP00000001267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]