SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001360 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001360
Domain Number 1 Region: 4-225
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 2.89e-57
Family DJ-1/PfpI 0.00000546
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001360   Gene: ENSMODG00000001143   Transcript: ENSMODT00000001388
Sequence length 226
Comment pep:novel chromosome:BROADO5:7:137222287:137230293:-1 gene:ENSMODG00000001143 transcript:ENSMODT00000001388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRKVALVLAGCGVFDGSELHEASAVMVHLSRSGAEVKIFAPNMEQMHVVNHLLGNPTE
EKRNVLVESARIARGNIQDLADLKVSEFDAVIFPGGFGVAKNLCSWAVDGKDCTVNNIVK
ATLQAFHSAKKPIGLCCISPVLAAKVFPGCEVTVGHDKNVDGRFPDAETATAIQELGCKH
ICKNVGESHVDSTNKIVTTCAFMCKAPLHEIFDGIGTMVGEVLKLA
Download sequence
Identical sequences F7D4G1
XP_007501532.1.35504 ENSMODP00000001360 13616.ENSMODP00000001360 ENSMODP00000001360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]