SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001443 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001443
Domain Number 1 Region: 881-1189
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.77e-107
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000957
Further Details:      
 
Domain Number 2 Region: 1164-1449
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.58e-78
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000171
Further Details:      
 
Domain Number 3 Region: 17-176
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.43e-37
Family MAM domain 0.000000582
Further Details:      
 
Domain Number 4 Region: 377-571
Classification Level Classification E-value
Superfamily Fibronectin type III 3.99e-28
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 5 Region: 274-400
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000292
Family Fibronectin type III 0.0069
Further Details:      
 
Domain Number 6 Region: 179-282
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000116
Family I set domains 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001443   Gene: ENSMODG00000001198   Transcript: ENSMODT00000001472
Sequence length 1450
Comment pep:novel chromosome:BROADO5:1:391340148:392362623:1 gene:ENSMODG00000001198 transcript:ENSMODT00000001472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVTLPPLPSPYSSIVASGCSFDEHYSSCGYSVALGTNGFTWEQINTWEKPMLDPAVPTGS
FMMVNSSGRASGQKAHLLLPTLKENDTHCVDFHYYLSSRDRSSPGSLNVYVKVNGGPQGN
PIWNVSGIVTEGWVKAELAISTFWPHFYQVIFESVSLKGHPGYIAVDEVRVLAHPCRKAP
HFLRLQNVEVNVGQNATFQCIAGGKWSQHDKLWLQQWNGRDTALMVTRVVNHRRFSATVS
VADTSQRSISKYRCVIRSDGGSGVSNYAELIVKEPPTPIAPPELLAVGATYLWIKPNANS
IIGDGPIILKEVEYRTTTGNWAETHIVDSPNYKLWHLDPDVEYEIRVLLTRPGEGGTGPP
GPPLTTRTKCADPVHGPQNVEIVDIRSRQLTLQWEPFGYAVTRCHSYNLTVQYQYVFNQQ
QYEAEEVIQTSSHYTLRGLRPFMTIQLRLVLSNPEGKMESEELVVQTEEDVPGAVPLESI
QGGPFEEKIYVQWKPPNETNGLITLYEINYKAVGSLDPNADLSSQRGKVFKLRNETHHLF
VGLYPGTTYSFTIKASTSKGFGPPITTRIATKISAPSMPEYDTDSPLNETDTTITVMLKP
ARSRGAPVSVYQLVVKEERLQKARRAADIIECFSVPVSYKNASSLDSLHYFAAELKPINL
PVTQPFTVGDNKTYNGYWNAPLSPLKSYSIYFQALSKANGETKINCIRLATKGTWESSSL
SSATPMCLKSKGASTQNSNAVEPEKQVDNTVKMAGVIAGLLMFVIILLGAMLTIKRRRNA
YSYSYYLPSRKLAKKQKETQSSTQREMGPVATTDKTNTKLSTARNDEGFSSSTQDVNGFT
GSSRGELAQPTLTIQTHPYRSCEPVEMSYPRDQFQPAIRVADLLQHITQMKRGQGYGFKE
EYEALPEGQTASWDTAKEDENRNKNRYGNIISYDHSRVRLLMLDGDPHSDYINANYIDGY
HRPRHYIATQGPMQETVKDFWRMIWQENSASVVMVTNLVEVGRVKCVRYWPDDTEVYGDI
KVTLIETEPLAEYVIRTFTVQKKGYHEIREIRLFHFTSWPDHGVPCYATGLLGFVRQVKF
LNPPEAGPIVVHCSAGAGRTGCFIAIDIMLDMAENEGVVDIFNCVRELRSQRVNLVQTEE
QYVFVHDAILEACLCGNTAIPVCEFRSIYYNISRLDPQTNSSQIKDEFQTLNIVTPRVRP
EDCSIGLLPRNHDKNRSMEVLPLDRCLPFLISVDGESSNYINAALMDSHKQPAAFIVTQH
PLPNTGADFWRLVFDYNCSSVVMLNEMDTAQLCMQYWPEKTSCCYGPIQVEFVSADIDED
IINRIFRICNMARPQDGYRIVQHLQYIGWPAYRDTPPSKRSLLKVVRRLEKWQEQYDGRD
GRTVVHCLNGGGRSGTFCAICSVCEMIQQQNIIDVFHIVKTLRNNKSNMVETLDQYKFVY
EVALEYLSSF
Download sequence
Identical sequences F7GH48
13616.ENSMODP00000001443 ENSMODP00000001443 ENSMODP00000001443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]