SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001498 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001498
Domain Number 1 Region: 1054-1183
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000596
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 2 Region: 615-686
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000458
Family TB module/8-cys domain 0.001
Further Details:      
 
Domain Number 3 Region: 1259-1330
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000746
Family TB module/8-cys domain 0.00085
Further Details:      
 
Domain Number 4 Region: 1324-1444
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000102
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 5 Region: 978-1046
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000017
Family TB module/8-cys domain 0.00034
Further Details:      
 
Domain Number 6 Region: 3-128
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000188
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 7 Region: 1452-1574
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000267
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number 8 Region: 455-528
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000144
Family TB module/8-cys domain 0.0001
Further Details:      
 
Domain Number 9 Region: 333-465
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000267
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 10 Region: 779-896
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000033
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 11 Region: 125-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000395
Family EGF-type module 0.012
Further Details:      
 
Domain Number 12 Region: 689-735
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000648
Family EGF-type module 0.0027
Further Details:      
 
Domain Number 13 Region: 209-346
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000879
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 14 Region: 534-589
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000257
Family EGF-type module 0.00092
Further Details:      
 
Domain Number 15 Region: 1170-1216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000781
Family EGF-type module 0.015
Further Details:      
 
Domain Number 16 Region: 1216-1262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000052
Family EGF-type module 0.014
Further Details:      
 
Domain Number 17 Region: 737-774
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000578
Family EGF-type module 0.014
Further Details:      
 
Domain Number 18 Region: 873-987
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000102
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 19 Region: 1573-1613
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000296
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000001498
Domain Number - Region: 587-622
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000267
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 166-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-type module 0.0073
Further Details:      
 
Domain Number - Region: 1707-1753
Classification Level Classification E-value
Superfamily Cadherin-like 0.0165
Family Cadherin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001498   Gene: ENSMODG00000001247   Transcript: ENSMODT00000001530
Sequence length 1792
Comment pep:novel chromosome:BROADO5:3:42886669:43055893:-1 gene:ENSMODG00000001247 transcript:ENSMODT00000001530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDECKISPDLCGSGTCVNTPGSFECECFEGYEIGFMMMKNCMDINECEHNSLLCRGGDCV
NAESNFECDCPLGHELSSLHEDCVDINECSLSDNMCRSGKCVNMIGLYQCTCNPGYQATP
DRQSCMDVDECMIMNGDCDTQCSNSESSYECNCSEGYTLMPDMRTCADIDECENNPGICD
GGRCGTNIPGVYHCLSYDGLMASVDMKTDVDVNECDIDSNICMFGECENTKGSFICHGQL
GYSGKKGTVGCADVDECDIGVHNCNMHTSCLNIQGNFKCSCRKGWVGNGFKCVDLDECSN
GSHQCNINAQCVNTTDSYHSTCFGGFTGDNFSCLDVDECAENINLCENGQCLNIPVTYNC
ECEMGFTPGSDCKSCQDIGECSFQNICVFGTCKNLPGEFHCICDDGYELDRTGGNCTDVD
EYADPINCVSGLCVNSPGRYESNCPLDFQLNPTGIGCVDNRVGNCYLKFGPHEDGSFSCN
TEIGVGISHSSCCCSLGKSWGNPGGSCPPVNSTDYYTHCPGSEGFRPNPITIILEDIDEC
QELPGLYQDGNSINTFGNFQCECPQGYYLSEESRICEDIDEYFPYPGVCGPGTCYNALGN
YTCICPPEYMQINGGHNCMDMKKSFCYRNYNKTTGENELPFNVAKRMCCCTYNVGKAWNK
PCEPNPTPGAVEFKAICGNIPGFTFDIHTGKAVDIDECKEIPSICANGVCINQIGSFHCE
CPTGFSYNDLLLVCEGTDECNSGKSIHHDANCLSILRSYYCECLAGFKLSPNSDLVVRNS
CLEIPNICSHSLCVDLQGSYQCVCHSGFKVSEDQTMCMDVNESDHLCGSEAWKNTVGSYN
CHCYPRFELTHHNDCLNIDECGSFFGQVYRNGQCFNEISSFKCLCNEGYEFTPDGKNYID
TNKCVTLLGSCSPEACQNLDESFRCICPGYDVKSENRIDINEYNEDPNICLFGSCTNTPG
SFQTVYPTSFILSDNGRRCFDPRQSFCFKNFENGMCTVPKAFCTTKAKYCYNKIPGEGWG
DSCELCSKNDEVAFQDLCPFGHGIVPGLHDTREDVNECLESPGICSNVQCINTNGSFPCE
CPMGYNFDYTGLHCVDTNECSIGNPCGNGTCINVIGSFECNCNDGFKSSPMMNCEDFNEY
AQNPLLCAFRCINTFGYYECTCPSSFSLREDQKMCKDLDECPEGLHDFESKGLMCKNLIG
TFMCICPTGMTQRPDGEDYIDENEWWTKPGIYENGHCINIVGSYKCECNEGFQSGSLDTE
CLDHRKGFCFAEVLQSMCHMTASSRNLVRKSECCCNERWGWGNQCELCPLSGTTQYRKIF
PHGPGYATDGRGMYCTMNVKLVCQCINTVASFRCFCNVGHTTDTSETSCVDLDECPQSLK
LCNFICKNNDGSYQCSCPRGYILQEDGKTCRDLGECQPKQQNCQFLCINTLGDFTCKCSP
EFTYMSHAFLENNECGYQPLLCEMRGICHNIPGSFSCECQRGFSLDSIGLKCGYVDECDG
NHRCQHSCQNILQGYKCGCPQGYIQHYQWNQCVDENECTNPNTCDSASCYNTLGTYKCAC
PSGFSFDQFSSECHDVNECSSTNNPCNFGCSNNEGGYLCGSPPGYYRVGQGHYVSGMGFN
KSQYLSVDTKVDKENTFSPETCYEFKINGYPKKDSRQKRDIEETEPTLVEKMSLENIDLD
TPIKMKFNFSSLGNKLHILEFIPAIESLNNHIRYIISQGNENGIFRIHQQDGLSYLHTAK
KKSVPGTYTLEITSIPLYKKKELKKLEDNNEDNYFLGELSEALRIRLHIQLY
Download sequence
Identical sequences K7E179
ENSMODP00000001498 ENSMODP00000039530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]