SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001542 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001542
Domain Number 1 Region: 59-835
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.48e-273
Family Motor proteins 0.00000000000000633
Further Details:      
 
Domain Number 2 Region: 836-960
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.71e-26
Family Myosin rod fragments 0.0000275
Further Details:      
 
Domain Number 3 Region: 1233-1349
Classification Level Classification E-value
Superfamily Myosin rod fragments 6.8e-21
Family Myosin rod fragments 0.0033
Further Details:      
 
Domain Number 4 Region: 952-1068
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.05e-19
Family Myosin rod fragments 0.0022
Further Details:      
 
Domain Number 5 Region: 1428-1549
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000000759
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number 6 Region: 1615-1834
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000157
Family Tropomyosin 0.00054
Further Details:      
 
Domain Number 7 Region: 1063-1179
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000602
Family Myosin rod fragments 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000001542
Domain Number - Region: 1813-1933
Classification Level Classification E-value
Superfamily Tropomyosin 0.000209
Family Tropomyosin 0.0097
Further Details:      
 
Domain Number - Region: 1353-1432
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0628
Family Myosin rod fragments 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001542   Gene: ENSMODG00000001273   Transcript: ENSMODT00000001574
Sequence length 1949
Comment pep:novel chromosome:BROADO5:6:83369961:83453881:1 gene:ENSMODG00000001273 transcript:ENSMODT00000001574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGGYKGECGDDVDPMPFLAPPEKERIEAMNKPYDIKRSCWVKDEKEGFIAGEIQSEQGD
QVTIKTITNQTVTMKKDDVQQMNPPKFYQASDMADMTFLNEASVLDNLCQRYTNMRIYTY
SGLFCVTVNPYRWLPIYGARVANMYKGKKRTEMPPHLFSISDNAYHDMLMDRENQSMLIT
GESGAGKTENTKKVIQYFANIGGTGKQSSDGKGSLEDQIIQANPVLEAFGNAKTTRNNNS
SRFGKFIRIHFGTTGKLAGADIESYLLEKSRVISQQAAERGYHIFYQILSNKKPELLESL
LLVSNPKEYHWISQGVTVVDNMDDGEELQITDVAFDVLGFSAEEKIGVYKLTGGIMHFGN
MKFKQKPREEQAEVDTTEVADKVAHLMGLNSGELQKGITRPRVKVGNEFVQKGQNMDQCN
NSIGALGKAIYDKMFKWLVVRINKTLDTKMQRQFFIGDLFLIIFLFSLLPLQFNSFEQLC
INFTNEKLQQFFNHHMFVLEQEEYKREGIEWVFIDFGLDLQACIDLLEKPMGIFSILEEQ
CVFPKATDATFKAALYDNHLGKSNNFLKPKGGKGKGPEAHFELVHYAGTVGYNITGWLEK
NKDPLNETVVGLFQKSSMNLLALLFKEEEAAAGSKKQKRGSSFMTVSNFYREQLNKLMTT
LHSTAPHFVRCIVPNEFKQSGVVDAHLIMHQLACNGVLEGIRICRKGFPNRLQYPEFKQR
YQVLNPNVIPQGFVDNKKASELLLGSIDIDVNEYKIGHTKVFFRAGILAKLEDMRDERLA
KIMTMLQCRLRGFLMRIEFKKMLERRIGLKVIQRNVRKFLQLRFWGWWKLYNKVKPLLNV
ARQEEEMKAKEEELRNAMSKTQELISRVKELEEKTATLSQEKNDLTIQLQAEQENLSDAE
ERLTQMMKTKMDLESQISDMRERLEEEEGTAASLSATKRKLEGEMSDLKRDLEGLETTLA
KTEKEKQALDHKVRTLSGDLSLREDSIAKLQKEKRALEELHQKTLDDLQAEEDKVNHLTK
NNSKLGTQIHELEDNWEQEKKIRAEVEKARRKAESDLKMTIDNLNEMERAKLDLEEVVKK
RDMEINSVNSKYEDEQSLNSTLQRKLKEHQARIEELEEELEAERAMRAKVEKQRSDLSRD
LEDLSDRLEEAGGATSAQIEQNRKREAELLKLRRELEEAALQSEATASTLRKKHTDSMAE
LTEHVENLQRVKAKLEKDKQVMKAEIDDLSASMETVQKSKVNAEAHVRKLEDNLSEANAK
VAELERNQAELNAIRTRLQAENSELSREYEESQSRLNQIFRMKTSLTSQVEDYKRQMEEE
SKSRSAAVVSLANTKHDLDLIKEQLEEEQGGKSELQRLVSKLNTEVTTWRTKYETDAIQR
TEELEETKRKLAARLQEAEEAAEAAQARAASLEKNKQRLQAEVEDLTIDLEKANAAAAAL
DKKQRVFDKMLAEWQQKCEELQVEVDSSQKECRMYMTESFKIKTAYEESIEHLESANRER
RLEQYEIKDLIDQLGEGGRSVHELQKLKKKLEIEKEELQVALEEAESSLEVEESKVIRIQ
LELAQVKADIDRRIHEKEEEFEATRKNHQRAIESLQASLEAEAKGRAEALRLKKKMETDL
NEMEIQLDHANKNNSELVKTLKRLQQQIKDLQIQMDEDARQHEELREQYNLQERRLSLLQ
TELEEVRSSLEGSERSRKLLEQEVVEITERHNEVNIQNQSLLVVKRKLESDIQRISNEHE
ELISEFRTADERAKKAMTDAARMAEELRQEQDHCMHLEKIKKNHELTIKDLQAKMEEAEQ
LALKGGKRTIMKLEAKIKELETELDSEQKRHVETVKILRKNERRLKELVFQTDEDHKTNQ
RMQELVEKLQNKLKVYKRQIDEAEEQANQSLARYRKTVHELDDAEERAGMAETALNKLRT
RHRVAGKGITSVEIIQVSKTGSSKTMSEE
Download sequence
Identical sequences F7CIF4
ENSMODP00000001542 13616.ENSMODP00000001542 ENSMODP00000001542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]