SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001598 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001598
Domain Number 1 Region: 176-450
Classification Level Classification E-value
Superfamily Caspase-like 2.24e-81
Family Caspase catalytic domain 0.000000000618
Further Details:      
 
Domain Number 2 Region: 32-122
Classification Level Classification E-value
Superfamily DEATH domain 1.98e-23
Family Caspase recruitment domain, CARD 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001598   Gene: ENSMODG00000001322   Transcript: ENSMODT00000001631
Sequence length 453
Comment pep:novel chromosome:BROADO5:8:206315737:206336157:1 gene:ENSMODG00000001322 transcript:ENSMODT00000001631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEARAGARPAFSRGVSTVGDGGRRMLGVWGMEQEHQEALKKNRVVLAKQLLLSELLEHL
LEKDIITLEMRELIQAKVGSFSQNVEFLNLLPKRGPHAFEAFCDALRETKQGHLEDLLHR
TLYSFQNLRPPLGCDYDSSFPLPVCDSCPPHKQLRLSVETMEHSLDNGDGPPSLQVKPCT
PEFYQTHQHLAYRLQSRPRGLAMVLSNVHFNGEKDLEFRSGGDVDHSSLVTLFKLLDYDV
HVLRDQTAQKMQENLQRFAQLSAHQSTDSCMVALLSHGIEGGIYGVDGKLLQLQEVFRLF
DNANCPNLQNKPKMFFIQACRGDETDRGVDLRDGKEHVASPGCEESDAGKEKILKMRLPT
RSDMICGYACLKGTAAMRNTKRGSWYIEALTQVFSERARDMHVADMLVKVNALIKDREGY
APGTEFHRSKEMSEYSSTLCRHLYLFPGHPPTQ
Download sequence
Identical sequences F7BDP8
XP_001366069.1.35504 ENSMODP00000001598 ENSMODP00000001598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]