SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001683 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000001683
Domain Number - Region: 733-799
Classification Level Classification E-value
Superfamily DEATH domain 0.0432
Family DEATH domain, DD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001683   Gene: ENSMODG00000001394   Transcript: ENSMODT00000001718
Sequence length 843
Comment pep:novel chromosome:BROADO5:8:303087734:303163039:1 gene:ENSMODG00000001394 transcript:ENSMODT00000001718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASGQASLKSEVVPRCKSEGNLLDEQNFFTHYDMEDCQDNNFLPDWSGVSPQNVGPISK
TTNPFWNELSASNPFLDDVAQLRNTGKNTNVSILKEDPFLFFREGEEDSSSGDELIFHQM
LRKSSSKKSGKSKSISELLDMVDRTPSIEISDQILPHDMEWLQNDREAYKMAWLSQRQLT
RSCLDLNTMSHSLGWAQTQVADTVIVCKLGSEGGSVQLPGSHITVHVPQGHVRTGEFQEV
TLRAFLDPPKTLNHDLSCTVSPLLEITLSNLNTMEAISLEMEISAEKRQDPFSQVMGTLT
CLYSSNKGGPFRELSNCYIYNDMIQVKLLELSNVMYIVAVAQCKAIQAPATSVWDFIHKT
IHVGVYGPRYIHPSFTVIFTLWGHSYMPNKLTITDINRNGKNVSPVVFQLWGKHSFLLEK
PHDLHISIFSEDLDFEVKPDEKRKEIKQEQLKAGEVIHQQFLFSATDSKILHSFLFLVRV
HIPNENSVAQFYVRSPDPAPNLARLPNQPNVLQKMEGIKYYPLSLPVTAKYPKFQNKTLN
FANYGVTLKTVLRQDKISYLLEYFKGDTIALLGGGKVKAIGQTKVKEWYVGVHQGKLGLV
HCKNVKVISREQVIDMSESGFTTQKLLEQAALPFKKMTYIYSTVLTLVAEKILDWKALAD
ALGYSELTAEDFDQMQVDKETERVSYVVKKLKEDCHVDRNRRSFLYELVVALLKIDCQGL
VMHLIRETAILTSAVKLGKGWRELAEKLVRLTKQQIEAYEIPHQGRTGEVITEMMWKPAY
DFLYTWGAHYGESYRDVLQDLQLALDRMKNPVTKHWRELTGALILVNCLDILRATSFHVS
EED
Download sequence
Identical sequences F7F5N1
XP_001372014.1.35504 XP_007505456.1.35504 XP_007505457.1.35504 XP_007505458.1.35504 XP_007505459.1.35504 XP_007505460.1.35504 ENSMODP00000001683 ENSMODP00000001683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]