SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001705 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001705
Domain Number 1 Region: 60-843
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.39e-290
Family Motor proteins 6.1e-18
Further Details:      
 
Domain Number 2 Region: 1240-1358
Classification Level Classification E-value
Superfamily Myosin rod fragments 3.01e-29
Family Myosin rod fragments 0.0052
Further Details:      
 
Domain Number 3 Region: 844-968
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.57e-27
Family Myosin rod fragments 0.00000155
Further Details:      
 
Domain Number 4 Region: 966-1076
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.18e-24
Family Myosin rod fragments 0.0014
Further Details:      
 
Domain Number 5 Region: 1435-1557
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000000000000034
Family Myosin rod fragments 0.0059
Further Details:      
 
Domain Number 6 Region: 1074-1188
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000217
Family Myosin rod fragments 0.0045
Further Details:      
 
Domain Number 7 Region: 1619-1809
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000222
Family Tropomyosin 0.0022
Further Details:      
 
Domain Number 8 Region: 1742-1936
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000915
Family Tropomyosin 0.001
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000001705
Domain Number - Region: 1357-1434
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0301
Family Myosin rod fragments 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001705   Gene: ENSMODG00000001389   Transcript: ENSMODT00000001740
Sequence length 1940
Comment pep:novel chromosome:BROADO5:2:243694708:243726003:-1 gene:ENSMODG00000001389 transcript:ENSMODT00000001740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATAMSSDAEMAVFGEAAPYLRKSEKERIEAQNKPFDAKNSVFVVEPKESYVKSTIQSREG
GKVTVKTEGGATLTVKEDQVFSMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYT
YSGLFCVTVNPYKWLPVYNPEVVAAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILI
TGESGAGKTVNTKRVIQYFATIAVTGDKKKEEPTPGKMQGTLEDQIISANPLLEAFGNAK
TVRNDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQIMSNKK
PELIEMLLITTNPYDFAFVSQGEITVPSIDDQEELIATDSAVDILGFSNDEKVAIYKLTG
AVMHYGNMKFKQKQREEQAEPDGTEVADKAAYLQSLNSADLLKALCYPRVKVGNEYVTKG
QTVQQVYNSVGALAKAIYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLE
QLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLAACIELIEKPMGIFSIL
EEECMFPKATDTSFKNKLYEQHLGKSNNFQKPKPAKGKAEAHFSLVHYAGTVDYNIAGWL
DKNKDPLNETVVGLYQKSSMKTLAFLFAGGAAAEAEGGGKKGGKKKGSSFQTVSALFREN
LNKLMTNLRSTHPHFVRCLIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRII
YADFKQRYKVLNASAIPEGQFIDSKKASEKLLGSIDIDHTQYKFGHTKVFFKAGLLGTLE
EMRDDKLAQLITRTQAICRGYLMRVEFKKMMERRESIFCIQYNVRAFMNVKHWPWMNLFF
KIKPLLKSAETEKEMANMKEEFEKAKEDLAKSEAKRKELEEKMVALTQEKNDLLLQVQSE
AEGLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDI
DDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLTKEKKALQEAHQQTLDDLQAEE
DKVNTLTKAKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESTMDIENDKA
QLDEKLKKKEFEMSNLQGKIEDEQALGMQLQKKIKELQARIEELEEEIEAERASRAKAEK
QRSDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHESTAAALRK
KHADSVAELGEQIDNLQRVKQKLEKEKSELKMEIDDLASNMETVSKAKANLEKMCRTLED
QLSEVKTKEEEQQRLINDLSAQRARLHTESGEFSRQLDEKDSLVSQLSRGKQAFTQQIEE
LKRQLEEETKAKNALAHALQSARHDCDLLREQYEEEQEAKAELQRAMSKANSEVAQWRTK
YETDAIQRTEELEEAKKKLAQRLQDAEEHVEAVNSKCASLEKTKQRLQNEVEDLMIDVER
SNAACAALDKKQRNFDKVLSEWKQKYEETQAELEASQKESRALSTELFKMKNAYEESLDQ
LETLKRENKNLQQEISDLTEQIATGGKQIHELEKIKKQIEQEKGELQAALEEAEASLEHE
EGKILRIQLELNQVKSEIDRKIAEKDEEIDQLKRNHLRVVESMQSTLDAEIRSRNDALRI
KKKMEGDLNEMEIQLNHANRQAAEALRNLRNTQGVLKDTQLHLDDAIRGQDDLKEQLAMV
ERRANLMQAEIEELRASLEQTERSRKVAEQELLDASERVQLLHTQNTSLINTKKKLETDI
TQIQGEMEDMVQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQ
HRLDEAEQLALKGGKKQIQKLEARVRELENEVENEQKRNVEVVKGLRKHERRVKELTYQT
EEDRKNVLRLQDLVDKLQTKVKAYKRQAEEAEEQSNVNLSKFRKIQHELEEAEERADIAE
SQVNKLRVKSREVHTKIVSE
Download sequence
Identical sequences F7BD45
ENSMODP00000001705 ENSMODP00000001705 13616.ENSMODP00000001705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]