SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001735 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001735
Domain Number 1 Region: 22-270,336-383
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.26e-103
Family Type II chitinase 0.0000000341
Further Details:      
 
Domain Number 2 Region: 397-450
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000012
Family Tachycitin 0.017
Further Details:      
 
Domain Number 3 Region: 266-309
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000000183
Family Chitinase insertion domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001735   Gene: ENSMODG00000023235   Transcript: ENSMODT00000001771
Sequence length 450
Comment pep:novel chromosome:BROADO5:2:481262962:481272081:-1 gene:ENSMODG00000023235 transcript:ENSMODT00000001771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLRRRHWSHALCSSSSPGATFKLVCYFTNWSQYRPDPAKYMPENVDPCMCTHLIYAFATM
SNNKIAPYEWNDDVLYPRFQALKQHNENLVTLLAIGGWNFGTQKFTTMVATAGNRKIFID
SVIEYLRQYGFDGIDLDFEYPGSRGSPPEDKQRFTILIEEMLAAFEAEAQATNRPRLLIS
AAVSAGKGTIDAGYEIAKIGALLDFISVMTYDFHGGWDTVTGHNSPLYQGSTDHGDFIYF
NSAFAMKYWRDNGVPAEKLIMGFPTYGRTMRLTSSDVSVGAPASGAGSVGPYTREAGFWA
YYEVISQGKQEQDNVSNKYTSTCIGHWWLLFTGVVEAYMEVEFLKENGFGGAMVWALDLD
DFLGTFCGEGSYPLLSNLKSLLGLETPGCVTPDPPKPTPPSTFCEGKADGIYADPDDPSR
FFECAHGNTVAKRCADGLVFNESCKCCDWP
Download sequence
Identical sequences F7BCG8
ENSMODP00000001735 13616.ENSMODP00000001735 ENSMODP00000001735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]