SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001739 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001739
Domain Number 1 Region: 22-268,336-387
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.23e-105
Family Type II chitinase 0.0000000424
Further Details:      
 
Domain Number 2 Region: 268-335
Classification Level Classification E-value
Superfamily Chitinase insertion domain 2.68e-24
Family Chitinase insertion domain 0.00017
Further Details:      
 
Domain Number 3 Region: 428-471
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000445
Family Tachycitin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001739   Gene: ENSMODG00000001433   Transcript: ENSMODT00000001775
Sequence length 471
Comment pep:novel chromosome:BROADO5:2:481236205:481249194:-1 gene:ENSMODG00000001433 transcript:ENSMODT00000001775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRMLLWACLALLLQVQLGSGYKLVCYFTNWSQYRPEPAKYFPKNVDPCLCTHLVYAFAT
MNENKIAPYEWNDIDVLYPQFRALKEQNKDLVNLLAIGGWNFGTQKFTTMVSSEANRKTF
ICSVIDFLRLHGFDGIDLDFEYPGSRGSPPEDKQRFTILIKEMLELFEQEAKETGFPRLL
ITAAVSAGKGTIDAGYEIAEIGKLLDFISVMTYDFHGGWDSCTGHNSPLHVGSKDQGDNR
YFNCEYAMKYWEDNGVPAEKLIMGFPTYGRTFRLTTSDTSVCAPASGAGSSGPYTREAGF
WAYYEICTFLKDATTVWIEDQKVPYAYKGNEWIGFDNVESYEHKVDFVKQNKFGGAMVWA
IDLDDFSGTFCNEGKHPLISKLRSLLGLSAGNSLMDSSTCSVRADWGALGMGNSKGTEQK
NHFLSWEETDGMYIDPENNTKFYQCAGGKTFHFQCANGLVFKENCMCCDWP
Download sequence
Identical sequences F7BCE1
ENSMODP00000001739 ENSMODP00000001739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]