SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001780 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001780
Domain Number 1 Region: 23-267,337-388
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.9e-114
Family Type II chitinase 0.00000000617
Further Details:      
 
Domain Number 2 Region: 267-336
Classification Level Classification E-value
Superfamily Chitinase insertion domain 6.11e-25
Family Chitinase insertion domain 0.0000422
Further Details:      
 
Domain Number 3 Region: 424-470
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000549
Family Tachycitin 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001780   Gene: ENSMODG00000001467   Transcript: ENSMODT00000001818
Sequence length 471
Comment pep:novel chromosome:BROADO5:2:481208059:481222732:1 gene:ENSMODG00000001467 transcript:ENSMODT00000001818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKLILLTGLALVLLAQLGSAYHLTCYFTNWAQYRPGLGRFKPENIDPCLCTHLIYAFAG
MSNNEITTIEWNDVTLYKSFNGLKNKNSELKTLLAIGGWNFGTAPFTTMVSTPENRQTFI
NSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKNLFTVLVKEMREAFEQEAKQINKPRLMV
TAAVAAGISNIESGYDIPQLSQYLDFIHVMTYDLHGSWEGYTGENSPLYKNPSDTGSNAY
LNVDYAMNYWKDHGAPAEKLIVGFPSYGHTFILSNPSETGIGAPTSGPGPAGPYTRQSGF
WAYYEICPFLKNGATEVWEASEDVPYAYKSNEWVGYDNPKSFQIKAEWLKKNNFGGAMVW
AIDLDDFTGTFCNQGKFPLINTLKKTLGLESAKSRRKNTVHPKLKPLLPRCHEPLHSHAG
GSGFCAGKADGLYPVANNRNAFWHCLNGNTYEQYCQAGLVFDPSCECCNWA
Download sequence
Identical sequences F7APD3
ENSMODP00000001780 ENSMODP00000001780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]