SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001788 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001788
Domain Number 1 Region: 4-207,277-328
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.62e-93
Family Type II chitinase 0.0000000469
Further Details:      
 
Domain Number 2 Region: 207-276
Classification Level Classification E-value
Superfamily Chitinase insertion domain 9.31e-26
Family Chitinase insertion domain 0.0000477
Further Details:      
 
Domain Number 3 Region: 376-423
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000889
Family Tachycitin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001788   Gene: ENSMODG00000001473   Transcript: ENSMODT00000001826
Sequence length 423
Comment pep:novel chromosome:BROADO5:2:481179975:481188718:1 gene:ENSMODG00000001473 transcript:ENSMODT00000001826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNNEISTIEWNDVTLYKSFNGLKNKNSELKTLLAIGGWNFGTAPFTTMVSTPENRQTFI
KSVIKFLRQYEFDGIDFDWEYPGSRGSPPQDKNLFTVLIKEMLEAFEQEAKQINKPRLMI
TAAVAAGISNIESGYDIPQLSQYLDFIHVMTYDLHGSWESYTGENSPLYKNPSDTGSNAY
LNVDYVMNYWKDHGAALEKLIVGFPAYGHTFMLSNPANHGIGAPTTGPGPAGPYTRQSGF
WAYYEICPFLKNGATEVWEASEDVPYAYKGNEWVGYDNPKSFQIKAEWLKKNNFGGAMVW
AIDLDDFTGTFCNQGKFPLINTLKKTLGLESASCKAPPEPIAPITEAPSKGSGDSGSSGS
GSSGSSSGGSPSGTGFCASRASGLYPDPTDKNAFYNCVNGRTYQEHCQAGLVFDASCSCC
DWA
Download sequence
Identical sequences F7AP39
ENSMODP00000001788 ENSMODP00000001788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]