SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001804 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001804
Domain Number 1 Region: 27-269,339-389
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.69e-97
Family Type II chitinase 0.0000000635
Further Details:      
 
Domain Number 2 Region: 269-338
Classification Level Classification E-value
Superfamily Chitinase insertion domain 3.51e-22
Family Chitinase insertion domain 0.0000887
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001804   Gene: ENSMODG00000001485   Transcript: ENSMODT00000001842
Sequence length 392
Comment pep:novel chromosome:BROADO5:2:481121540:481137153:1 gene:ENSMODG00000001485 transcript:ENSMODT00000001842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGAAVMDQKLLWLGLVALMLLQGGSAYKLVCYFTNWAQYRAGHAYFIPDTIDPNLCTHLI
YSFAKINNNKIAPREWNDATLYHTFNNLKKRNPNLKTLLSIGGSKFGSKGFHPMVDSSES
QSTFVNSVIPFLRNYGFNGLDIDWIYPETSEKSLFASLIHELAVAFREEAKKSGKEKLLL
SAGVAAGRQIIDNSYSIKELASDVDFVNLLTFNFHGSWDNPLLTGHNSPLRKGSQDQRNS
NYYNVEYAVKYWKTQGMPGKKIIMGIPMYGRSFTLPTPVSNTGVGVPAQGAGTPGQFTAE
EGFLAYYEVCQFLQGATVTKIPEQQVPYAVKGNQWVGFDNVESVEAKVQFLKDSGLGGAM
IWSIDLDDFTGEFCKEGSFPLLQAIRKKLGTA
Download sequence
Identical sequences F7F4T7
ENSMODP00000001804 ENSMODP00000001804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]