SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001964 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001964
Domain Number 1 Region: 19-110
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 4.45e-45
Family SWIB/MDM2 domain 0.0000739
Further Details:      
 
Domain Number 2 Region: 296-340
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 2.98e-17
Family Ran binding protein zinc finger-like 0.00015
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000001964
Domain Number - Region: 443-488
Classification Level Classification E-value
Superfamily RING/U-box 0.0194
Family RING finger domain, C3HC4 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001964   Gene: ENSMODG00000001605   Transcript: ENSMODT00000002006
Sequence length 496
Comment pep:novel chromosome:BROADO5:2:110022354:110069666:1 gene:ENSMODG00000001605 transcript:ENSMODT00000002006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSPTSTHCSASENACKISPGQVNQVRPKLPLLKILQAAGAHGEMFTMKEVMHYLGQYI
MVKQLYDQQEQHMVYCGGDLLGELLGLQSFSVKDPSPLYDMLRKNLVTATVFSFCFTHRL
DAAQTLALAQDQSMDIPSQDQLKQGTEGSSSSRNGTEEGDDPALSTSQRKCRNPKEDEDL
IENLVPNKSPRLDLMFEEWDVAGLPWWFLGNLRNNYTPRSNGSTDLQTNQDIDTAIVSDT
TDDLWFLNESNSEQLNVAVKVEATDTEQASEGGKEGDKKLIEVRIFDDLEDSQCLSDDTD
TEINSEDEWQCTKCKKFNSPSKRYCFRCWALRKDWYSDCPKLSHSLSVSNITAMPTKKDD
QGIDVPDCRRTISDPLVRPKEAYKIEEKPKLMDPCSSVEFLDLAQSSESQETVSSLGEQS
DNLYEQKTDAMAMEDYKNLFKPCKLCEKRPRDGNIIHGRTAHLVVCFRCAKRLKKTQAPC
PICKKSIQMVIKIFVA
Download sequence
Identical sequences F7BAJ5
ENSMODP00000001964 ENSMODP00000001964 13616.ENSMODP00000001964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]