SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002002 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002002
Domain Number 1 Region: 216-396
Classification Level Classification E-value
Superfamily MIR domain 4.05e-47
Family MIR domain 0.0019
Further Details:      
 
Domain Number 2 Region: 1075-1166
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-18
Family SPRY domain 0.05
Further Details:      
 
Domain Number 3 Region: 3899-3977
Classification Level Classification E-value
Superfamily EF-hand 0.00000000513
Family Calmodulin-like 0.034
Further Details:      
 
Domain Number 4 Region: 655-802
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000121
Family SPRY domain 0.049
Further Details:      
 
Domain Number 5 Region: 429-545
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000000248
Family IP3 receptor type 1 binding core, domain 2 0.019
Further Details:      
 
Domain Number 6 Region: 2055-2119
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000445
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 
Domain Number 7 Region: 1323-1451
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000103
Family SPRY domain 0.022
Further Details:      
 
Domain Number 8 Region: 100-181
Classification Level Classification E-value
Superfamily MIR domain 0.0000327
Family MIR domain 0.029
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002002
Domain Number - Region: 539-617,1721-1731,1791-1821,1969-2130,2394-2496,2535-2575
Classification Level Classification E-value
Superfamily ARM repeat 0.00132
Family Armadillo repeat 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002002   Gene: ENSMODG00000001626   Transcript: ENSMODT00000002044
Sequence length 4864
Comment pep:novel chromosome:BROADO5:1:187413706:188193535:-1 gene:ENSMODG00000001626 transcript:ENSMODT00000002044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGGGEKKKVDYRNEDEVVLQCVANIHKEQRKFCLAAEGLGNRLCFLEPTSEAKYVPPDLC
ICNFVLEQSLSVRALQEMLANTGENANEGVAQGGGHRTLLYGHAILLRHSFSRMYLTCLT
TSRSQTDKLAFDVGLQEHATGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSERYLHL
SISNGNIQVDASFMQTLWNVHPTCSGSSIEEGYLLGGHVVRFFHGHDECLTTQSTDQNDS
QHRRIFYETGGAGSRARSLWRVEPLRISWSGSNIRWGQAFRLRHITTGQYLALTEDQGLI
LQDRGKSDTKSTAFCFRASKEIKEKLDSSHKRDIEGMGIAEIKYGDSICFVQHVASGLWM
TYKAQDAKTSRLGPLKRKVILHQEGHMDDGLTLQRCQHEESQAARIIRNTTSLFSQFISG
NNRTAAPITLPIEEVLQTLKDLITYFQPPEEEMQHEDKQNKLRSLKNRQNLFKEEGMLAL
VLNCIDRLNVYNSVAHFTGFAREESGTAWKEILNLLYQLLAALIRGNRNNCAQFSNNLDW
LISKLDRLESSSGILEVLHCILIESPEALNLISEGHIKSIISLLDKHGRNHKVLDVLCSL
CLCNGVAVRANQNLICDNLLPRRDLLLQTRLINDVTSIRPNIFLGVAEGSAQYRRWYFEL
IIDQVDPFLTAEPTHLRVGWASSPGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLWSGRI
PRAVASVNQHLLKSDDVVSCCLDLGVPSISFRINGQPVQGMFENFSTDGLFFPVVSFSAG
IKVRFLLGGRHGEFKFLPPSGYAPCYEALLPKEKMILESVKEYKRDTEGIRDLLGTTRFL
SQASFIPCPIDTSQIVLPPHLEKIRDRLAENIHELWGMNKIELGWTFGKIRDDNKRQHPC
LVEFSKLPETEKNYNLQMSTETLKTLLALGCHIVHINLAAEEDLKKAKLPKNYMMSNGYK
PSPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLVPYAL
LDERTKKSNRDSLREAVRTFIGYGYNVEPSDQELADQTMEKVSVDKIRFFRVEQSYAVKS
GKWYFEFEVVTGGDMRVGWARPGCRPDIELGADNQAFVFEGSKGQRWHQGSGYFGRNWQS
GDVVGCMINLDDASMIFTLNGELLITNKGSELAFADYEIENGFVPICSLGLSQIGRMNLG
MDASTFKYYTMCGLQEGFEPFAVNMNRDVAMWFSKRLPTFVNVPKDHTHIEVTRIDGTID
APPCLKVTHKTFGTQNSSADMIYCRLSMPVECYSSFHHSTGLESDIFQKRKQMQEIVAHT
TTQCYYSVRIFAGQDPSYTWIGWVTPDYHLYSEKFDLNKNCTVTVTLGDERGRVHESVKR
SNCYMIWGGDIIANSQRSSRSNVDLEIGCLIDLATGMISFSANGKELDTCYQVEPNTKVF
PAVFLQPTSTSLVQFELGKLKNAMPLSAAIFKSEEKNLVPQCPPRLDVQTIQPVLWSRMP
NSFLKIEMERVSERHGWMVQCLEPLQMMALHIPEENRCVDILELCEQEDLMRFHYHTLKL
YSAVCALGNNRVAYALCSHVDLSQLFYTIDNQYLPGLLRCGFYDLLISIHLAHAKEGKLM
MKNEFIIPITNTTRKIRLYPDESKRHGLPGVGLSTCLKPGFNFSTPCFIVTSEERQKLSP
EIPLEILKTKALSMLTEAVQCSGAHIRDPVGGSVEFQFVPVLKLIGTLLVMGVFDNDDVR
QILLLIDPTVFGEHKDEAQESTEKEVTHVEEKAVEAGEKSSKNTQAPVRGLLQTRLPESV
KLQMCELLNYFCDCELQHRVEAIVAFGDIYVSKLQANQKFRYNELMQALNMSAALTAKKT
REFRSPPQEQINMLLNFQMGENCPCPEEIREELYDFHDDLLIHCGIPLEEEEEEEEDISW
TGKLRALIYKIKGPPKPEKEQPMEEEEKCPTTLKELISQTMVCWAQEDQIQNPELVRIMF
NLLRRQYDSIGELLQAMRKTYTISHASVEDTINLLAALGQIRSLLSVRMGKEEELLMING
LGDIMNNKVFYQHPNLMRVLGMHETVMEVMVNVLGGEKSQIAFPKMVASCCRFLCYFCRI
SRQNQKAMFEHLSYLLENSSVGLASPAMRGSTPLDVAASSVMDNNELALGLEEPDLEKVV
TYLAGCGLQSCPMLLARGYPDIGWNPIEGERYLSFLRFAVFVNSESVEENASVVVKLLIR
RPECFGPALRGEGGNGLLAAMQGAIKISENPTLDLPSQGYKREISSEEDDSEEEIVHMGN
SIMSFYSALIDLLGRCAPEMHLIQTGKGEAIRIRSILRSLVPTEDLVGIISIALKLPTLN
KDGSVNEPDMAANFCPDHKAPMVLFLDRVYGIEDQTFLLHLLEVGFLPDLRASASLDTVS
LSTTEAALALNRYLCSAVLPLLTRHAPLFAGTEHYTSLIDSTLQTIYRLSKGRSLTKAQR
DTIEECLLAICNHLRPSMLQQLLRRLVFDVPLLNEYCKMPLKLLTNHYEQCWKYYCLPSG
WGSYGLAVEEELHLTEKLFWGIFDSLSHKKYDAELFRMALPCLSAIAGALPPDYLDTRIT
ATLEKQTSVDAEGNFDPKPINTINYSLPEKLEYVVTKYAEHSHDKWACDKSQNGWKYGIS
LDENVKTHPLIRPFKTLTEKEKEIYRWPARESLKTMLAVGWTVERTRESEAIIQQRENEK
LRSISQTSQGNSYNPAPLDLSNVVLSREVQGMVEVVAENYHNIWAKKKKMELESKGGGSH
PLLVPYDTLTAKEKFRDREKSQELFKFLQVNGIVVSRDLKDMELDTSSMEKRFAYKFLKK
ILKYVDSAQEFIAHLEAIVSSGKTEKSPHDQEIKFFAKVLLPLVDQYFTNHCLYFLSSPL
KPLSSSGYASNKEKEMVASLFCKLAALVRHRISLFGSDSTTMVSCLHILAQTLDTRTVMK
SGSELVKAGLRAFFENAAEDLEKTSENLKLGKFTHSRTQIKGVSQNINYTTVALLPILTS
IYEHVAQHQFGVDLLLSDVQISCYHILCSLYSLGTGKNIYVERQRPALGECLASLAAAMP
VAFLEPSLNCYNSLSVFNTKTPRERSILGMPDTVEEMCLDIPQLEGLMKEIYDLAESGAR
YTEMPHVIEVILPMLCNYLSYWWEQGPENLPPSAGPCCTLVTSEHLSIILGNILKIINNN
LGIDEASWMKRIAVYAQPIISKARSDLLKSHFIPTLEKLKKKAVKIVLEEEQLKADSKGD
TQEAELLILDEFAVLCRDLYAFYPMLIRYVDNNRSNWLKNPDADSDELFRMVAEVFILWC
KSHNFKREEQNFVIQNEINNLAFLTGDSKSKMSKGINFSGGQDQERKKTKRRGDLYSIQT
SLIVAALKKMLPIGLNMCTPGDQELISLAKIRYGYRDTDEEVKDHLRNNLHLQEKSDDPA
VKWQLNLYKDVLKNEEPCDPEKTVERVQRISAAVFHLEQVEQPLRSKKAVWHKLLSKQRK
RAVVACFRMAPLYNLPHRSINLFLHGYQRFWIETEEYSFEEKLVQDLAKPPKVEEEEEED
AENQPDPLHQIILHFSRNALTERSHLEDDPLYTAYSGMMAKSCQSGEEEEEEEKEKTFEE
KEMEKQKTLYQQARLHDRGAAEMVLQMISASKGEMGPMVVETLKLGIAILNGGNPGVQQK
MLDYLKEKKDAGFFQSLSGLMQSCSVLDLNAFERQNKAEGLGMVTEEGTLIVRERGEKVL
QNHEFTCDLFRFLQLLCEGHNSDFQNFLRTQMGNTTTVNIIISTVDYLLRLQESISDFYW
YYSGKDIIDESGQRNFSKALAVTKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVVGFLHV
FANMQMKLSQDSSQIELLKELLDLLQDMVVMLLSLLEGNVVNGTIGKQMVDTLVESSTNV
EMILKFFDMFLKLKDLTNSDAFKEYDPDGKGIISKKEFQKAMEGQKQYPQSEIEFLLSCA
EADENDMFNYVDFVDRFHEPAKDIGFNVAVLLTNLSEHMPNDSRLQCLLDPAESVLNYFE
PYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEKMELFV
NFCEDTIFEMQLASQISESDSAERLEEEEDEEEFSCVVEAEEDEEENKSLESASAFATAC
VSIKKNVASFLKMVSLRNLRKQYRKVKKMTVKELVKVFFSFFWMFFVGLFQLFFTVVWGI
FQILWNTVFGGGLVEGAKNIRVTKILGDMPDPTQFGIHDDVLEAERAEVTEQNVTAELVH
FVKGEKGEADIMSDLFGLHTKKEGNTKHGPDPGLGDLSEIIGNDGPLTLESTVQKKRKAQ
AAEMKRESEREGKMESEKADMEDGEKQDKIKEEEQQEENLDGERTKKKRRHGQREERPEA
FMANFFKGLEIYQTKMLHYLARNFYNLRFLALFVAFAINFILLFYKVTEEPFEDDAENSN
LWTPFKEEEEEEEGMVFFVLQESTGYMAPTLRALAIIHTIISFVCVVGYYCLKVPLVVFK
REKEIARKLEFDGLYITGQPSEDDIKGQWDRLVINTPSFPSNYWDKFVKRKVINKYGDLY
GAERIAELLGLDKNALDFSPVEQTEPEEASLVSWLSSIDMKYHIWKLGVVFTDNSFLYLA
WYTTMSILGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTV
VAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDPYEIYR
IVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVREDMETKCFICGIGNDYFDTTPH
GFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYE
DQLG
Download sequence
Identical sequences F6TN69
ENSMODP00000002002 13616.ENSMODP00000002002 ENSMODP00000002002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]