SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002007 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002007
Domain Number 1 Region: 266-545
Classification Level Classification E-value
Superfamily ClpP/crotonase 7.29e-83
Family Biotin dependent carboxylase carboxyltransferase domain 0.0000251
Further Details:      
 
Domain Number 2 Region: 51-298
Classification Level Classification E-value
Superfamily ClpP/crotonase 9.78e-71
Family Biotin dependent carboxylase carboxyltransferase domain 0.0000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002007   Gene: ENSMODG00000001640   Transcript: ENSMODT00000002050
Sequence length 564
Comment pep:novel chromosome:BROADO5:3:45203615:45301439:1 gene:ENSMODG00000001640 transcript:ENSMODT00000002050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSAVRSGVRVLLPSRFAPSSRPYHGDAVATLGSQLDKGSALYQENYERMKALVTELHER
TEHIRLGGGEKARKLHLSRGKLLPRERINRLLDPGSPFLEFSQFAGYQLYGKEEVPAAGI
ITGIGRVSGVECLIVANDATVKGGTYYPVTVKKHLRAQEIALENKLPCLYLVDSGGANLP
RQAEVFPDRDHFGRIFYNQAMMSSKNISQIAVVMGSCTAGGAYVPAMADESIIVKKQGTI
FLGGPPLVKAATGEEVSAEDLGGADLHCRKSGVTDHYALDDSHALHLARKIVRSLNYNKK
LEVTVEPSEEPLFPIDELYGIVGDNLKRNFDIREVIARIVDGSRFDEFKALYGDTLVTGF
ARIFGYPVGIIGNNGVLFSESAKKGTHFIQLCCQRKIPLVFLQNITGFMVGKEYEAGGIA
KDGAKMVTAVACANVPKITIILGGSYGAGNYGMCGRAYSPRFLYIWPNARISVMGGEQAA
NVLATIARDQKTREGKEFSSEEEAALKDPIIKRFEEEGNPYYSSARLWDDGIIDPADTRL
VLGLSISAALNAPIKKTNFGIFKM
Download sequence
Identical sequences F6T882
XP_007486563.1.35504 13616.ENSMODP00000002007 ENSMODP00000002007 ENSMODP00000002007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]