SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002037 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002037
Domain Number 1 Region: 96-303
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.000000000117
Family STM3548-like 0.063
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002037
Domain Number - Region: 11-84
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.000961
Family Class I glutamine amidotransferases (GAT) 0.069
Further Details:      
 
Domain Number - Region: 327-377
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.087
Family ThuA-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002037   Gene: ENSMODG00000001667   Transcript: ENSMODT00000002080
Sequence length 916
Comment pep:novel chromosome:BROADO5:8:207384082:207403002:1 gene:ENSMODG00000001667 transcript:ENSMODT00000002080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSPSDDFEILLKGLNSWNLPNGPVPCELLLIGEAAFPVLVNKDGQVIIAASRYGQGRMV
VMSHESYLQDRMLAQFLFNAMGWLNQCPGAAVGVHTSVEPLTHILSDFGVEVQTMDGLED
SIGVYCINAYDSTLAKEMIQFVKNGGGLLIGGQAWYWASKHGCDKVLSNFPGNQVTSVAG
VYFTDAYGKTDFLKVSKKVPKIPLTVRFGEDLSQDQQQLLHGITELDINTGGLPSQLLVH
GALAFPLGLDSSLGCFLAGARYGQGRVVLAAHEGMLCAPKLGPFLCNAINWLAGGQTGRI
GVNPNLKNLYSLVAESGLECSIESHLTTGLSVYCCTAYSDQEAEKIHEFVAEGRGLLIGG
QAWWWASQNPGKPAVADYPGNHILNPFGLSILDSSLKSGQFPVHVPSKGNYHFRSALSQF
QDEVKGGEVLAKDWQSKLRKDCGAFLKIPAEGVPAYASLHRFLRKVIKQTGLPHVSQDHP
VHSNSCEATLLCMATELAQNGTTDCFSLVHRASNGTCPSQVYSPGPPVTMEINGTSPDFT
LWVSTGLYLPEGFPVNITMPCAAATGLQVQIGCHSDDLNGAKKLCRAPVVIHRCCLDKPE
LSVSSLWGGLIYILVPQGSNLGPVSITITGAVPAPYFKLGETNLEEWKSIIRYHPVPWGE
LATDNIILTVPSEHLQDLEDPEPLLHLWDEMMGAIAQLAAKPFPFPRPERIVADVQISAG
WMHSGYPIMCHKKSAEEIVNEKRIRSSGLWGPIHELGHNQQQQVWEFPPHTTEATCNLWS
VYIHEMVLNIPRSQAHPALTPSDRETRVREYLGKGTPLKEWSVWTALETYLQLQEAFGWE
PFIQIFTEYQTLSGVPNNNAGKMNLWVKKFSHQVQRNLVPFFQAWGWPVQEEVAASLACL
PEWQDNPMNVYLLMEN
Download sequence
Identical sequences F6SR91
ENSMODP00000002037 ENSMODP00000002037 XP_007504570.1.35504 XP_007504571.1.35504 13616.ENSMODP00000002037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]