SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002097 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002097
Domain Number 1 Region: 50-504
Classification Level Classification E-value
Superfamily Cytochrome P450 1.57e-117
Family Cytochrome P450 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002097   Gene: ENSMODG00000001709   Transcript: ENSMODT00000002140
Sequence length 514
Comment pep:novel chromosome:BROADO5:2:7691554:7716124:1 gene:ENSMODG00000001709 transcript:ENSMODT00000002140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLSWLSIWLPVSFPRLWLWSIALVLALGLLQLTRLLARRQKLLRALDSFPGPPIHWLFG
HAKEIKGEGALDKIISWANTYPSAHPLWFGRFIGFLNIYDPDYAKAVYSRGDPKAWDIYG
FFIPWIGKGLLVLEGPKWFQHRKLLTPAFHNAVLKSYVGLFAESTQDMLDKWEKKVRVNK
CVEIFNDVGFMALDTLMKCIFGKTSRGQTKSDTDYYLAIADLTLLMQERVHAFQYHNDFL
YWLTPHGRNFLRACKVAHDHTDKVIRERKAILKGEMLEKTQKKRHLDFLDILLGVKDENK
IHMSDMDLRAEVDTFMFEGHDTTTSSISWFLYCMALYPEHQNRCRKEIQEILQGRDTVQW
EDLGKMTYLTLCIKESFRLFPAVPQVYRQLSKPVTFADGRSLPEGSLVSLHIYALHRNRT
VWTDPEVFDPQRFTPENTSTRHPFAFLPFSAGPRNCIGQQFAMMEMKVVTALCLLHFEFS
PDPTQPPIKQTQLILRSKNGIHLNMNKLKMNTRA
Download sequence
Identical sequences F6RMC1
13616.ENSMODP00000002097 ENSMODP00000002097 ENSMODP00000002097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]