SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002100 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002100
Domain Number 1 Region: 463-582
Classification Level Classification E-value
Superfamily Cadherin-like 3.53e-25
Family Cadherin 0.0016
Further Details:      
 
Domain Number 2 Region: 131-241
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-22
Family Cadherin 0.0021
Further Details:      
 
Domain Number 3 Region: 237-357
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-18
Family Cadherin 0.0023
Further Details:      
 
Domain Number 4 Region: 572-681
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000002
Family Cadherin 0.00091
Further Details:      
 
Domain Number 5 Region: 41-137
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000005
Family Cadherin 0.008
Further Details:      
 
Domain Number 6 Region: 350-467
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000214
Family Cadherin 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002100   Gene: ENSMODG00000001715   Transcript: ENSMODT00000002143
Sequence length 861
Comment pep:novel chromosome:BROADO5:1:65381041:65434552:1 gene:ENSMODG00000001715 transcript:ENSMODT00000002143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKYGQQFPASLVLGLVQVCLAQANFAPYFYDNGASSTNGNMALFSLSEDTPVGSHVYTLN
GTDPEGDFVTYGISFESSSRNFFSIDPNFGNITLIEELDREREDEIEAIISISDGINRVS
EKVLILVTDANDEAPQFINTPYIILVPEDTPAGSSIFKVQALDKDTGSGGSVTYFLQNLH
SNKFTMDRHSGVLRISVGATLDYEKSRTHFITVLAKDGGGRLRGDYVVFSATTTITINVD
DVQDTAPIFVGTPYYGYVYEDSHPGSEILTVVAVDGDRGNPNMVLYNFVNGSDEAFRINE
TTGAISVVVSPSQLKKEVYELRVQVSEVSSSGVLAAQVSTTVTIRVVDLNNHPPTFYGEN
GLQNMFELTMYEHPSEGEILRGLRITVNDSDQGANAKFNLRLVGAGGIFRVVPQTVLNEA
QVTIIVENSAAIDFEKIKLLTFKLLAVEVNTPEKFSSTADIVIHLLDTNDNVPKFSSDYY
IARIPENSPGGSNVVAVAAMDPDSGLWGEVKYSIYGAGAELFLIHPSAGIIYTQPWAALD
AEVTSKYNFYVKAEDTEGKYSLAEVFVTVLDVNDHSPEFDENIQETTMVLGTPVKIEATD
HDAEEPNNVVDYSIMQAEPANVFDINESTGEIRLKAFVHSLDIIHNITKNRDCTWSVLVQ
AKDRGSPSFSTTAVLKIDILDETLHRGPMAAFLMQTKDNPMKAVGVLAGVIAIMVVITVF
ISTAMFWRNKKSNKILPIRRVIRKRPSPPSRTIRAEWLKFKRSHAGDKFAVKDELPNENH
NNNSLMFTPPPTAPALPPPPTPIPKISPTEWTVPTVSGSLTPKHTRKLLKEKALESPVQS
ALVSELKQKFEKKAMDNKPYF
Download sequence
Identical sequences F6XGG0
ENSMODP00000002100 13616.ENSMODP00000002100 XP_001371001.1.35504 ENSMODP00000002100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]