SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002158 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002158
Domain Number 1 Region: 291-474
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-45
Family SPRY domain 0.00012
Further Details:      
 
Domain Number 2 Region: 5-78
Classification Level Classification E-value
Superfamily RING/U-box 2.7e-20
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 89-150
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000133
Family B-box zinc-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002158   Gene: ENSMODG00000001764   Transcript: ENSMODT00000002203
Sequence length 481
Comment pep:novel chromosome:BROADO5:3:400316809:400318533:1 gene:ENSMODG00000001764 transcript:ENSMODT00000002203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAKQLFESLKVDLTCPICLRYFTDPVVIKCAHNFCRECLLQYLEEANTPATCPVCRTVL
KSGAFLCNKRLQNLAITVKMLQSHFQQSIRGLTTCDKHGKEENLFCEDDHKPLCGSCFLS
TEHKEHKMLPLEKAAGQCMAELQESWNVLRDRKEKFQKELECEKRREFSCKVEGHILRGS
VTSEFEKMHQFYLEEERLHLQRLDQEARDSSAILDQEARDNLAMFEESKARLSQLIHNLQ
MVMSEIEGNFEKPFIEMLQDGRRTLGRKEELLLQEPVVALPRWTKFSIPGMAEMLKTFQR
DLTLDPETASSRLMVSSDLKRVRYVCAPQDLPADNPQLSDFPVAVLAMQSFISGKHYWEV
EVGDAIHWQVGICQVTDSKQRQILVWAEYTSIGFRFGNDLDYWNSYDDIHVRPPIHKFGI
FLDYERGHIALYNAVDKTLLYSPRRVAFHGPLHPSFSLYPPNEQITHGSLIICPRSKQGR
D
Download sequence
Identical sequences F6WZ82
ENSMODP00000002158 13616.ENSMODP00000002158 ENSMODP00000002158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]