SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002170 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002170
Domain Number 1 Region: 175-532
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.52e-122
Family beta-N-acetylhexosaminidase catalytic domain 0.0000000000353
Further Details:      
 
Domain Number 2 Region: 31-174
Classification Level Classification E-value
Superfamily beta-N-acetylhexosaminidase-like domain 1.92e-32
Family beta-N-acetylhexosaminidase domain 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002170   Gene: ENSMODG00000001771   Transcript: ENSMODT00000002215
Sequence length 535
Comment pep:novel chromosome:BROADO5:1:65519098:65537132:1 gene:ENSMODG00000001771 transcript:ENSMODT00000002215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISLEHTGVLLLLTLLAVGTLAQTQVLEASVWPWPQNIRVSPNQTFALNPSLFHFQYSAA
SAVQPGCSVLDEAFVRYLRIIFGTGPWLSPDRPDLKITVKNSLDVLVAVPGCDLFPEMNS
LENYTLTLSNQQFVLKSHTVWGALRGLETFSQLIGRSAEGMFYVNCTDIVDFPRFPHRGL
LLDTSRHYLPLQTILETLDVMAYNKFNVFHWHIVDDPSFPYESVNFPELSRKGSYDPASH
IYTMEDVKTVIEYARLRGIRVLAEFDTPGHTLSWGKGIPGLLTPCYSGSVPSGSYGPVNP
ILNRTYEFMASFFQEISDVFPDFYLHLGGDEVDFTCWQSNPDIQAFMKEKGFQNYEQLES
FYIQKLLNIVSSYRKGYIVWQEVFDNDVKLSPDTVVHVWRETKPVPYAMEMKNITKAGYR
VLLSSPWYLNRISYGQDWQKIYSVEPLDFEGSPEQESLVIGGEACMWGEFVDMTNLTPRL
WPRAGAVAERLWSSKSVNDTKLAYARLANFRCELLRRGVQAQPLFVGFCEHDFYH
Download sequence
Identical sequences F6WJB8
ENSMODP00000002170 XP_007478591.1.35504 ENSMODP00000002170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]