SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002189 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002189
Domain Number 1 Region: 342-552
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.18e-35
Family Laminin G-like module 0.0061
Further Details:      
 
Domain Number 2 Region: 161-335
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-35
Family Laminin G-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002189   Gene: ENSMODG00000001806   Transcript: ENSMODT00000002234
Sequence length 696
Comment pep:novel chromosome:BROADO5:8:210966762:211685250:1 gene:ENSMODG00000001806 transcript:ENSMODT00000002234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEDKVWSTVNHDLQKQTPVVGSGPEKYSVVQLNYSASMDQITAITSSAEYCEQFVSYSCK
MSRLINVPNGSPYTWWVGKANEKHYYWGGSGPGIQKCACGIERNCTDSKYYCNCDADHKQ
WRKDVGLLSYKDHLPVSQVVVGDTDRPGSEAKLTVGPVRCQGDRNYWNAASFFTPSSYLY
FSTFQGETSADISFYFKTSAADGVFLENLGNTDFIKLELKSATEVSFSFDVGNGPVEIVV
RSPSPLNDDQWHRVIAERNVKQASLQVDQLPQQVRKAPTEGHTRLELYSQLYVGAAGGQR
GFLGCIRSLRMNGVTLDLEERAKVTLGVKPGCSGHCTSYGMYCENGGKCVEKYNGYSCDC
SKTAYDGPFCIKDVGAFFEEGMWLRYNFQAPGTKDGASRSGNSVDSQNLTPDLAKEELSF
SFSTTKAPCILLYVSSHTPDFVAVLVKSSGNLQVRYNLGGTKEPYNIDVDHRNMANGQPH
SVNITRNEKDIILQLDHYSPVSYSLPSSSDTLFNSPKSLFLGKVIETGKIDQEIHTYNTP
GFTGCLSRVQFNQIAPLKAALRQTNASSQVHIQGELVESNCGASPLTIPPMSAATDPWHL
DSAFTASADFPYNAGQAIRDGVNRNSAIIGGVIAVVIFTILCTLVFLIRYMFRHKGTYHT
NEAKGAESAESADAAIMNHDPNFTETIDESKKEWLI
Download sequence
Identical sequences F6T5W5
ENSMODP00000002189 13616.ENSMODP00000002205 ENSMODP00000002205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]