SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002282 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002282
Domain Number 1 Region: 184-537
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.01e-117
Family beta-N-acetylhexosaminidase catalytic domain 0.000000000147
Further Details:      
 
Domain Number 2 Region: 38-183
Classification Level Classification E-value
Superfamily beta-N-acetylhexosaminidase-like domain 2.97e-35
Family beta-N-acetylhexosaminidase domain 0.0000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002282   Gene: ENSMODG00000001872   Transcript: ENSMODT00000002329
Sequence length 538
Comment pep:novel chromosome:BROADO5:3:49634200:49664447:1 gene:ENSMODG00000001872 transcript:ENSMODT00000002329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRVFCPRVMSPSALLLLLPLLLLAGVPLAAAATRPALWPLPVSVQQTPNLLYLSPVSF
EITHGLDSSAGPDCFLLQDAFRRYHQYVFGYSENPDVSRMSSSVGTEIQKLVVVITSDSE
CNAYPNITSDESYKLVVQASVAVLEARKVWGALRGLETFSQLVYRDSYGAYVINETEVTD
FPRFPFRGILIDTSRHYLPLKTILMTLDAMAFNKFNVLHWHIVDDNSFPYQSMAFPELSG
KGAFSHAHVYTHTDIRHVLDYARLRGIRVIPEFDSPGHTNAWGKGQENLLTACYAGSQKT
GFFGPVNPILNTTYDFLSTFFKEVSQVFPDNYIHLGGDEVDFSCWKSNPDVTKFMEEQGF
GQSYEKLESYYIQKLVDIVSSTNKGNLVWQEVFDNKVKLNPQTTIVEVWKGSYYEKELSD
VTAAGFATVLLSPWYLDYISYGQDWRRYYYVEPLQFSGTSTQKELVLGGTAALWGEYVDA
TNLMPRLWPRASAVGERLWSSKQVRDENDAYNRLTEHRCRMVRRGIPAEPLYVGYCEL
Download sequence
Identical sequences F6S6D6
ENSMODP00000002282 XP_001368242.2.35504 ENSMODP00000002282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]