SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002300 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002300
Domain Number 1 Region: 274-387
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.63e-22
Family Canonical RBD 0.000081
Further Details:      
 
Domain Number 2 Region: 416-455
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000000000549
Family Ran binding protein zinc finger-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002300   Gene: ENSMODG00000001889   Transcript: ENSMODT00000002348
Sequence length 527
Comment pep:novel chromosome:BROADO5:6:86075784:86086235:1 gene:ENSMODG00000001889 transcript:ENSMODT00000002348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNEYTQPATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYGQSADTSGYGQSSYGSSYG
QTQNTGYGTQSAPQGYGSTSGYGSSQSSQPSYGQQSSYPGYSQQPAPSSTSGSYGSSSQS
SSYGQPQSGGYGQQSGYGGQQQSSYGQQQSSYNPPQGYGQQNQYNSSSGGGGGGGGGSYG
QDQSSMSGGSGGGYGNQDQSGGGSSSSYGGGQQDRGGRGRGGGGGSSSGGGGYNRNSGGY
EPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIE
SVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEF
SGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGFGGGGSGGGSRGGFPSGGGGGGG
QQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNFGDDRRGGRGGY
DRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
Download sequence
Identical sequences F6WGL5
ENSMODP00000002300 XP_001364792.1.35504 ENSMODP00000002300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]