SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002303 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002303
Domain Number 1 Region: 40-429
Classification Level Classification E-value
Superfamily Cytochrome P450 1.57e-87
Family Cytochrome P450 0.0000651
Further Details:      
 
Domain Number 2 Region: 472-552
Classification Level Classification E-value
Superfamily Cytochrome P450 4.71e-21
Family Cytochrome P450 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002303   Gene: ENSMODG00000001890   Transcript: ENSMODT00000002351
Sequence length 553
Comment pep:novel chromosome:BROADO5:2:7828543:7854592:-1 gene:ENSMODG00000001890 transcript:ENSMODT00000002351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTGLGLAWLPRDFSSFLQTSVLLSLVLLLLKGVQLYRRRQWLLRTFQNFPGPPAHWFNG
HFWEYQKADEITVTLFWAKQFPSAFPRWFSGFTVALQVYDPEYMRILLGRPDPKADKFYR
LLAPWIGKGLLILNGSTWFQHRRLLTPAFHYDILKPYVALMVDSVLVMLKKWEKLITQDS
SLEIFEHVSLMTLDTIMKCAFSYHSNCQMERNADDYIQAVKEQAILVFSRVRNDLYHNDF
VYWFSPQGYQARRWAHLAHNHTDQVIKKRKQHLHQEGGLEAILKKRHLDFLDILLCSKTE
NGDSLSDKELRAEVDTFMFEGHDTTASGISWLLYSLAMNPEHQQKCREEIRDLLGDEMAI
GWEHLNRMPYTTMCIKESLRLYPPVTSISRDLSKPLTLSDGRYLPAGTIVTLHIHALHHN
PSVWPEPETLLKVPRLSCSLSSTVLEFLGSQTLSWLGSQTLSSSRDIQEQQVFNPLRFSP
ENLTSRHTHSFLPFSAGTRNCIGQQFAMNEMKVAVALTLLHFHLEPDATQPPQLFPRVVL
RSKNGIHLKLTRI
Download sequence
Identical sequences F6WGJ1
ENSMODP00000002303 ENSMODP00000002303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]