SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002406 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002406
Domain Number 1 Region: 101-384
Classification Level Classification E-value
Superfamily L domain-like 3.27e-51
Family Ngr ectodomain-like 0.0047
Further Details:      
 
Domain Number 2 Region: 403-711
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.83e-44
Family Rhodopsin-like 0.00055
Further Details:      
 
Domain Number 3 Region: 26-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000982
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002406   Gene: ENSMODG00000001973   Transcript: ENSMODT00000002456
Sequence length 758
Comment pep:novel chromosome:BROADO5:5:116488754:116698987:-1 gene:ENSMODG00000001973 transcript:ENSMODT00000002456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAGSIFFYILIIGKYFVHGTEHDSQCSLGYFPCGNATKCLPQLLHCNGVDDCGNQADEE
NCGDNNGWSQQLDKYFANNYKMISLYPFETETSECLVESVPVKCLCQGLELDCDEANLRA
VPSVSSNVTMMSLQWNLLKKLPSDGFKKYQDLQKLYLQNNKIRSVSVYAFRGLHNLTKLY
LSHNKITVLKPGVFEDLHRLEWLIIEDNQLSRISPLTFYGLNSLILLALMNNSLVHLPDK
PLCQHMPRLHWLDFEGNHIHNLRNMTFISCSTLTVLVMRKNEINHLNENSFAPLQKLDEL
DLASNKIEALPPYLFKDLKELSQLNLSYNPIQKIQADQFDYLVKLKSLSLEGIEISNIQR
RMFAPLRNLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQRVFVWVVSAVTC
FGNIFVICMRPYIRSENKLHALSIISLCCADCLMGIYLFVIGAFDLKYRGEYNKHAQLWM
DSTYCQLVGSLAILSTEVSVLLLTFLTLEKYICIVYPFRCLKPGKCRTITILILIWIIGF
VVAFIPLSNKEFFKNYYGTNGVCFPLHSEQGESMGAQIYSVVIFLGVNLAAFIIIVFSYG
SMFYSVHQTAVTATEIRNHVKKEVTLAKRFFFIVFTDALCWIPIFILKFLSLLQVEIPGT
ITSWVVIFILPINSALNPILYTLTTRPFKEMIRQVWSNYKQRRSIESKGSQKTYTPSFIW
VEMWPVQEIPPELIKPALFTDSCEMSLITQSTRINSYT
Download sequence
Identical sequences F6RIP7
XP_007496237.1.35504 ENSMODP00000002406 ENSMODP00000002406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]