SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002437 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002437
Domain Number 1 Region: 1-72
Classification Level Classification E-value
Superfamily Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 9.42e-22
Family Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000342
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002437   Gene: ENSMODG00000001998   Transcript: ENSMODT00000002488
Sequence length 73
Comment pep:novel chromosome:BROADO5:2:8420917:8421663:-1 gene:ENSMODG00000001998 transcript:ENSMODT00000002488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDDEEKELVDPLDTVREYCEQMEKCMKAREKLELCADRVNSRSHTEEDCTEELFDFLHAR
DHCVSHHKLSSLR
Download sequence
Identical sequences F6RHS1
ENSMODP00000002437 13616.ENSMODP00000002437 ENSMODP00000002437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]