SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002461 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002461
Domain Number 1 Region: 426-515,567-747
Classification Level Classification E-value
Superfamily RNI-like 2.09e-27
Family 28-residue LRR 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002461
Domain Number - Region: 201-252
Classification Level Classification E-value
Superfamily Cytochrome P450 0.00917
Family Cytochrome P450 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002461   Gene: ENSMODG00000002018   Transcript: ENSMODT00000002512
Sequence length 782
Comment pep:novel chromosome:BROADO5:2:8426213:8441815:1 gene:ENSMODG00000002018 transcript:ENSMODT00000002512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGLPPLPNMAAPRPRDFSANPDSRESIAAAAMEATPGERNLQAGLEPSGPPALYVLCGW
AVSAHMGVLESGVWALPGPILQGILPLLNIYYLERAEHAAQEKGLSTQSIWHQLWDDVMR
TRPPHSESVPCWRTKFLETFFCHVLRGTLDPASDWRLQDSRFSALLHSSPYVTQLTVCNA
LQGVRELVAEAQHGALETLAHSLHTLKFRHLLFSDGTAHRALRKLLHRLIHHGAIRQVSM
YSWPVPETTLFILILTMSAGLWQPAPCDGPCSLCGEDTPGRAPVRHEPVSLLRPGQPCRN
SAERSAAALMATRWENEAREAQQQAMLAQESRTLGEANPESPLGSSSAPQTLASSTLQPQ
EAPRRKSPCTHPWQGPGTEPDDLYDFIFLIASEKEEEEEEEEEEEQEEEKEEMWKPGCWD
LASLDAAQRFRSISTLDLFTIPLSTESTLVLCHLLSSWVSLEKLTLSYNGLGSNIFHLLE
GLQVLSAQAGCSLRSLHFTDLFSPLSVLELAHSTLKVLPRLHTLAIRIDHLSPDDSPRPP
GKPSPGTENEEIPETCLEQLELGFPRKPQASKCLCQVLEASPALQQLALDNATFTSPQEL
GLVLQTLRECNLVLQKLSLHDMNLTDCQKEVLLLFQDPTLRELTLSFCRLLEKRRTHFLP
KLVTALKSNSTLKSFRLPGNRLGSSGLVALAEIFSSDSSSTLCQLDISSNCIKPDGLLEF
SKQLEQSRSNRGTFGHLCLFQNWLDQDPSVTQEALGRLRTTFSVVSDTWDSSQAFADYVS
VM
Download sequence
Identical sequences F6QX65
ENSMODP00000002461 ENSMODP00000002461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]