SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002483 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002483
Domain Number 1 Region: 100-223
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.0000858
Family Amylase, catalytic domain 0.033
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002483
Domain Number - Region: 152-385
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.0178
Family Amylase, catalytic domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002483   Gene: ENSMODG00000002037   Transcript: ENSMODT00000002535
Sequence length 690
Comment pep:novel chromosome:BROADO5:2:238136641:238157538:-1 gene:ENSMODG00000002037 transcript:ENSMODT00000002535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEERQNLVFREMVNYEPTPLPVRNYDKNTSEPVSFYLSSLEELLAWIPNSDDAFNIAMIP
LAARQPSLQSERPRTLLCHDMMGGYLDDRFIQGSMKETPYTFYHWQFIDIFVYFSHHTVT
IPPVGWTNAAHKHGVCVLGTLITEWTEGGRLCEKFLSGNPSSYQKVADQLVRIAQFFHFD
GWLINIENQLSMAAVKNTPSFLRYLTDQLHQYIPDGLVIWYDSVVKDGQLKWQNELNESN
RIFFDSCDGLFTNYNWKEAHLERMASVEKRKADVYVGVDIFARGNVVGGGFDTNKSLELI
RKHGFSAALFAPGWVYECLDNKDFFQNQDRFWSLLEKYLPTHSICSLPFVTSFCLGMGIR
RLSYGQEETLGPWYHLSAQEIQPIFGDHIQENGSGWLRIHSCLMDAWNGGSSLLVRGMIP
VTTGKVTMRLFSLQVLAPPKLFLSLTYKLEGRTDIAVALELSTLDVGRCNIGDISSLHAE
PSIRHTPRPLQEPPAKLLGWVDRCNQQFNGGWIRRCYEVNLQNCFLQDIFVNFSRPLGSQ
KDENFTCRLGEIQVVDADSLMTPLPQVRDITASHTCWQQIHSERNRFKTKLLLSCTLRWS
YPISQACCFRVYHLGGSCSRRQELLKSEEPTFLGLAHASMYRVVNLVVEEAPAGQECFVD
FLIQPVPKEGFLVPQAEWGSLTLLYSKPNA
Download sequence
Identical sequences F6QW59
ENSMODP00000002483 XP_016286223.1.35504 ENSMODP00000002483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]