SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002521 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002521
Domain Number 1 Region: 329-632
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.99e-87
Family Tail specific protease, catalytic domain 0.0000000135
Further Details:      
 
Domain Number 2 Region: 25-327
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.44e-83
Family Tail specific protease, catalytic domain 0.00000508
Further Details:      
 
Domain Number 3 Region: 646-937
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.15e-78
Family Tail specific protease, catalytic domain 0.00000256
Further Details:      
 
Domain Number 4 Region: 937-1230
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.15e-78
Family Tail specific protease, catalytic domain 0.00000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002521   Gene: ENSMODG00000002069   Transcript: ENSMODT00000002573
Sequence length 1237
Comment pep:novel chromosome:BROADO5:1:66939608:66957088:-1 gene:ENSMODG00000002069 transcript:ENSMODT00000002573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSQCLLLFSALLFSLAHAEQIFQPSLVRDMAKILLDNYCFPENLMGMQEVIEQAIKSGE
ILDISDPQMLASVLTAGVQGALNDPRLVISFEPSIPETPQHVPKLANVTQEELLILLQQM
IKYQVLEGNVGYLRVDYIPGQEVVEKVGEFLVNNIWKKLMGTSSLVLDLQHSSGGEISGI
PFVISYLHQGDILLHVDTVYDRPSNTTTEIWTLPQVLGERYGGEKDMVVLTSHRTVGVAE
DIAYILKKLRRAIVVGEQTLGGALDLRKLRIGQSDFFITVPVSRSLSPLGGGSQTWEGSG
VLPCVGIPAEQALGKALAILTLRRARPGAIQRLMEVLQNYYTLVDRVPALLHHLTAIDYS
SVLTEEDLAAKLNAGLQAVSEDPRLLVRVLRPEEATMGSEASEEEDATPAANSLPEDESQ
RQALVDSVFQVSVLPGNVGYLRFDEFADSSVLGTLAPYVIRQVWEPLQDTNHLIMDLRYN
PGGPSSAVPLLLSYFQDPAAGPIRLFTTYDRQTNQTQEHLSRAELLGKPYGAQRGVYLLT
SHHTATAAEEFAFLMQSLGRATLVGEITAGSLMHTRTFPLLQPPNGNLVLTVPILTFIDN
NGECWLGGGVVPDAIVLAEEALDKAKEVLEFHQRLGALVEGTGHLLEAHYALPEVVGQAS
ALLKAKLEHGTYRTAVDFESLASQLTSDLQEVSGDHRLHVFHSPGEPVSEELTPPQKGVP
SPEELTYLIEALFKTEVLPGQLGYLRFDMMAEAETVRAIAPQLVELVWEKLVHTEALVVD
LRYNPGGYSTAVPLLCSYFFEAEPRRHLYTIFDRAASQLTEVWTLPQVAGERYGSQKDLY
ILISHTSGSAAEAFVHTMKDQHRATVIGEPTGGGALSVGIYQVENSPLYASMPTQVAISP
VTGKAWDMAGVEPDVSVLSSEALMTTQGIVALRAKVPTILQTAGKLVADNYASLEVGSRV
ASKLAKLQTQYRQVTSEGELADMLGADLQTLSGDRHLKTAHIPEDAKDRIPGIVPMQLPS
PEAFEDLIKFSFHTNVFEGNIGYLRFDMFGDCELLTQVSDLLVEHVWKKVVHTDGMIIDM
RFNIGGPTSSISALCSYFFDEGQEVLLDQIYNRPNDSISEIWTQSQVAGERYGSKKSVII
LTSSMTAGAAEEFVYVMQRLGRALVIGEVTSGGCQPPQTYHVDDTDLYITIPTARSVGSG
DKPSWEGVGVAPHVEVPADQALSKAKEMFNHHLQRAK
Download sequence
Identical sequences F6UZZ3
13616.ENSMODP00000002521 ENSMODP00000002521 ENSMODP00000002521 XP_001371866.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]