SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002559 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002559
Domain Number 1 Region: 45-481
Classification Level Classification E-value
Superfamily Cytochrome P450 1.2e-78
Family Cytochrome P450 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002559   Gene: ENSMODG00000002101   Transcript: ENSMODT00000002613
Sequence length 502
Comment pep:novel chromosome:BROADO5:1:181959271:181991052:-1 gene:ENSMODG00000002101 transcript:ENSMODT00000002613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILEMLNPMHYNLTGMVPEAMPAATMPILLLTCFLLLVWSYEDTSLIPGPGYCMGIGPLL
SHGRFLWMGIGSACNYYNKMYGEFMRVWICGEETLIISKSSSMFHIMKHSHYISRFGSKL
GLQCIGMHENGVIFNNNPALWKAIRPFFTKALSGPGLVRMVAVWYNSTVIHLDKLEDVTN
EGYGHVLNLMRRIMLDTSNVSLLGIPLDENAIVVKIQSYFDAWQALLLKPDIFFKISWLY
KKYEKSVKDLKDALEILIEEKRHRLSTDDKLEDCMDFASQLIFAQGRGDLTGENVNQCIL
EMLIAAPDTLSVTVYFMLLLIAKHPKVEEAVMKEIQTVIGKRDIKIGDVQKLKVVESFIY
ESMRYQPVVDLVMRKALQDDVIDGYPVKRGTNIILNIGRMHRLEFFPKPNEFTLENFAKN
VPHRYFQPFGFGPRGCAGKYIAMVMMKVILVTVLRRFHVQTLTGCCLERIQKKNDLSLHP
DETRDFLEMIFIPRNTEKCQEQ
Download sequence
Identical sequences F6UH76
13616.ENSMODP00000002559 ENSMODP00000002559 ENSMODP00000002559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]