SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002694 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002694
Domain Number 1 Region: 16-108
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000174
Family Caspase recruitment domain, CARD 0.021
Further Details:      
 
Domain Number 2 Region: 850-990
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000069
Family Nucleotide and nucleoside kinases 0.0066
Further Details:      
 
Domain Number 3 Region: 576-657
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000124
Family PDZ domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002694
Domain Number - Region: 672-731
Classification Level Classification E-value
Superfamily SH3-domain 0.00621
Family SH3-domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002694   Gene: ENSMODG00000002213   Transcript: ENSMODT00000002749
Sequence length 996
Comment pep:novel chromosome:BROADO5:2:235693270:235761773:-1 gene:ENSMODG00000002213 transcript:ENSMODT00000002749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELCPTHYELTTLDEENLWEIMENHRHKIVHNVYPNRLTPYLRQAKVLDQLDEEEVLHS
PKFTNNAMRVGYLLDVLKTRGKTGAIALVEKKFHNPDIYTLVTGLEPSVDSGSFRLIDTS
TLTECLASAIKSLQQELSQEKLRSHVLQQQCQKLKEQLHKLEVQNKSLGDMEAEHNRMKR
EVSAHFHQVLKLKDDMYNLSMRYTSALQDKDLAITRCQSLQEELYLMKQELHRVQMSSSC
EHESRERSLKSRNDLEPEEDELSQLKEDTEKLNSLTFSQAEKDILEQNLDEALDSKQELV
DRIHSLRERAVTAEKERKQYLEEKEKTFFQFQKIKVDFEIYKEKTNALQCQVVELQKERD
QAYKARDLAQMDIAHSLTEKDSLRRKVFELTDEVCELRKQLQKMQAEPMSEIKEDAGEPS
KKGKQRLTRMYAINPQEDRDFSLLSSTEHWPDLSTTSNQEPMGSFCSSSPVPPCKQSLCK
RVTEDFLEDSISISSSQEILNRDSGVSSAEKLDDIELTYEMGGKGGLPGTENIQKAFFPS
PCSPESNVLKRRRPARKILSQVTGLAFQGDSFLDQISIIGGNHTGIFIHRVTPGSAADEM
ALRSGTQIIMVDYDSKEVTFKAILEDTTLEQAIGLLKRVNGFCSLSVKVNMEGYKRLVQD
IENKVTTSGDSFYIRVNLSMEGKADGELQVQCNDILHVTDTMYQGQSCWHAHRVNLYSKK
DTEHGTIPNYSRAQQQLITIIQDMTHQRKVIRKSSGGQQKLVRIISMDNTKANPLWSSLD
GSQAESSKLEESSMLCFWAESCFTLVPYTLVKPYKPDKPRPVLFVPMVIGRILSEKLSLL
KDFEKCPSEYLSQEEYEAQRQKGDIIHEKEEPSHHSCVTYKAIVSLMQKNIHCLLDIRLD
CLQALHRIEIFPIIVHIPVTEKNAKKLRKALQRLGTTEEQILEAAKCEEADLERAPCLYA
SLVPDGWNDADSLANYARLAVTDEQKKFVWIEQGPR
Download sequence
Identical sequences F7G3D4
ENSMODP00000002694 ENSMODP00000002694 13616.ENSMODP00000002694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]