SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002780 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002780
Domain Number 1 Region: 480-660,753-771,803-938
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000158
Family Armadillo repeat 0.064
Further Details:      
 
Domain Number 2 Region: 1080-1217
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000257
Family Clostridium neurotoxins, the second last domain 0.092
Further Details:      
 
Domain Number 3 Region: 151-434
Classification Level Classification E-value
Superfamily ARM repeat 0.0000329
Family Exportin HEAT-like repeat 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002780   Gene: ENSMODG00000002279   Transcript: ENSMODT00000002835
Sequence length 1286
Comment pep:novel chromosome:BROADO5:1:68554637:68679610:1 gene:ENSMODG00000002279 transcript:ENSMODT00000002835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKEELLKEQKDVYNRTDQEASTGDLLQPEILQRGHPQCPTALWEMLERQFLEYAQTAPF
LNPENQQRTLLRLLPLFLKAWEKSAGIICFPSIHEFSEEVSKNFAQEIQKALVGKPAEEA
RLAIGQLFQWKGEEENDGYLLLKSSYLLTQADSETLGKIIESGLPGLLLQCLYIFFAFPL
DKDELFEGDSQVHKMFVQMMLNIYSDPQGVEELILGNELQSLLVATSSLWEQSSPSWKEP
TFSVLKAISKAQSPSIISYLHTSNSMKIAIQNLSKLVDTLPPQEVSEVASLMLNFVMDSY
SISSTLLLEFENSDGYPTLLKILLRYGEVPDNEAEPYLEELLELLVWLTVCGKTELKVFD
SVTYPQLDGFKFQNEPSGMTVKNLQAFQVLQNAFQKTNDSLLCRKILSTIKTMWTWNGRN
FFILEWTLQPISQFVEIIHLKPPVAQMLFFQLLESIVFDLTFIPHEILKKAQNLIKENLV
PSCTLVALRSIQRIITRDLLFTDIFRDSGLLGLLLAQLRKHAKIMRKTGSRELSGFNDIE
KDLACVMLKIVASLLQGSVRNTVVLKDHGMVPFIKIFLDDECYRSDSLSILEQLSTINSE
EYMSIIIGALCSSTQGELHLKLDLLKSLLKILENPKGRSAFRTSSGFNGLLSLLSDMEGS
LQDPPLEIWAPITPSQAMELVLYTLCAMTAALHLDSVNRDFFRRNNLFEKLAEDLCLLGC
FGTQEQGKVLPQPFIIEKARTFAELLNAAFSPSEAFPSVLRSCLQILSFLDSMARGTLPL
GNGLKEWKRVPEELAIDLQKDMSIHPDEHSSTDKSTFRPLITRGWPNLDDRMDDVDAVIM
HPGVVCVMLRLLPSLYHEDHPQLSKEIQCSLANHIQSLVKSEKNRQVMCEAGLLKTIITF
CHKALTDSSDPLHLSLIRIFEKLASQAIEPDILRQFLSLGIPSAKEAGCKTINTSLFQGD
NSCHSDMKTGLEAPAPPGTDSSVKTISDDSLSVSTVPSSKSSGAPKSSANILQTAMSLIS
MTSPRNIQPQKATLAPSFVEFDMSVEGYGCLFIPTLSTVMGPNTEHSISGGIGIGPRLFP
PLNGLTFSSWFLISKHSSLQNIHPIRFLTLVRHMARTEHQFVCFSISFSPEDLTLTVSTE
EKEFEPLDVMEPEDIHEPSAGSRLQFHCGNLLSSGQWHHLAVVVSKEMKRNCAVSTYING
QLIGSAKMLYIQTLPGSFLSMDPSSFIDVYGYIGTPQVWKQKSSLIWRLGPAYLLEEALS
KETLEVINKLGPRYCGNFQAVKFQGM
Download sequence
Identical sequences F7CVQ4
ENSMODP00000002780 ENSMODP00000002780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]