SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002854 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002854
Domain Number 1 Region: 2207-2300
Classification Level Classification E-value
Superfamily C-type lectin-like 1.46e-30
Family Link domain 0.00018
Further Details:      
 
Domain Number 2 Region: 980-1132
Classification Level Classification E-value
Superfamily FAS1 domain 4.19e-28
Family FAS1 domain 0.0016
Further Details:      
 
Domain Number 3 Region: 1584-1736
Classification Level Classification E-value
Superfamily FAS1 domain 1.1e-26
Family FAS1 domain 0.0017
Further Details:      
 
Domain Number 4 Region: 522-655
Classification Level Classification E-value
Superfamily FAS1 domain 2.09e-23
Family FAS1 domain 0.002
Further Details:      
 
Domain Number 5 Region: 1751-1892
Classification Level Classification E-value
Superfamily FAS1 domain 3.4e-23
Family FAS1 domain 0.0031
Further Details:      
 
Domain Number 6 Region: 338-504
Classification Level Classification E-value
Superfamily FAS1 domain 1.07e-20
Family FAS1 domain 0.0021
Further Details:      
 
Domain Number 7 Region: 1139-1272
Classification Level Classification E-value
Superfamily FAS1 domain 1.18e-20
Family FAS1 domain 0.0035
Further Details:      
 
Domain Number 8 Region: 2297-2458
Classification Level Classification E-value
Superfamily FAS1 domain 7.06e-20
Family FAS1 domain 0.0092
Further Details:      
 
Domain Number 9 Region: 1520-1578
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family EGF-type module 0.064
Further Details:      
 
Domain Number 10 Region: 1481-1535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000691
Family EGF-type module 0.079
Further Details:      
 
Domain Number 11 Region: 822-967
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000267
Family Growth factor receptor domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002854
Domain Number - Region: 240-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000105
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 2095-2131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000126
Family Merozoite surface protein 1 (MSP-1) 0.037
Further Details:      
 
Domain Number - Region: 2141-2174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00124
Family EGF-like domain of nidogen-1 0.099
Further Details:      
 
Domain Number - Region: 2009-2132
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00188
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 198-236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00481
Family Merozoite surface protein 1 (MSP-1) 0.031
Further Details:      
 
Domain Number - Region: 1443-1476
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0318
Family EGF-like domain of nidogen-1 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002854   Gene: ENSMODG00000002340   Transcript: ENSMODT00000002910
Sequence length 2560
Comment pep:novel chromosome:BROADO5:8:83282268:83466649:1 gene:ENSMODG00000002340 transcript:ENSMODT00000002910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKSLKPSILIGFILHLLCSLAETLEQANRCDKKTLITTRTECQSCSLNLHINCPDGYTK
VTNGSSGVRDCRYSFKVRDYALSLPGCRHICRKEYVQPLCCPGFWGPDCMECPGGKKSPC
SGRGHCSDGIEGNGSCICSEGFGGTACETCVEENLFGLNCTSVCNCVHGVCNSGLDGDGT
CLCYSAYTGPNCDKPIPECEALLCPENSRCSTSSMDESILECKCIANYKGDGWHCEPINP
CLERVCDVNAHCTYLGPNRHQCTCQDGYKGDGQVCVPIDPCQEDFGGCPTQSTVCQYDGP
GQSHCECKEHYQSFVPGLGCSLMDLCESRNPCHKNANCSMRGPGQTECTCQKGYVGDGSM
CYGNIMEQLQNLNTEPRGQWQGKLTSFISLLDKAYAWPLSNLGPFTVLVPTNKGLKGTNV
KELLTDKENAQYFVKLHIIAGQVDTEGLNSTDTFYTLTGKLGEIFSGDKDNQLRLKLSGG
KKKGKIVQGNIIASNGILHIIDKAMDKMAPVFESNTEQTIMAMLQPRYSKFRSLLEVTNV
GHALDEDGVGGPYTIFVPSNEALNSMKDGVLDYLLSAEGSRKLLELVRYHIVPFTQLEVA
NIISKPHIRTMANQIIQFNTTSNGQILANEVAMEEVEVAAKNGRIYTLAGVLIPPSIVPI
LPHRCDETQREMKLGTCVSCSMVYWSVCPANSVPLSLFTSNCVYGRKIGSQKFPTKGCAR
YCNATVKIPKCCKGFYGPDCNQCPGGFSNPCSGNGQCADGLSGNGTCICDNGFQGSRCQF
CSDPRKYGPQCEKKCLCVHGTCDNQIDSDGACLLGTCKDGSAGQFCDKQTTACGPYVHFC
HIHARCEYSSRTARCVCNQGYEGDGTICTEVDPCAGIIPGGCSINAECVKTGTGTHTCVC
QPGWTGDGRDCSAINNCLLPNFGGCHDNATCLYVGPGQHNCECKAGFRGNGIDCEPITSC
LEQTKKCHPLATCQSTSSGLWSCVCQDSYEGDGIMCYGNVAVELSLLSEAALFNQWVNEA
SSQAMLSGTSNLTVLVPSQQAIENMDQAEKTFWLSKNNIPTLIKYHALVGTYRTSDLQIL
SSSDMLATSLQGNFLHLSKVNGNITIEGANIVDSDNAATNGVIHIIDKVLLPQRSMSASL
PNLLTRLDQMPDYSIFRGYIIASIHQYSLANAIEAADAYTVFAPNNDAITNYIREKTTTT
LEENILRYHIILEEKLLKNDLHNGMHRETMLGVSYLIGFFLQNGQLYVNEAPVNYTNVAT
DKGVIHGLGKVLEIQKNRCDSNYTTILRGRCEYCLRKHCPPGTKPVEEEAKKCIYMTYFM
GKRSMHIGCQTKCIKTVITKECCAGFFGPQCQLCPGKAGNACFGNGICLDGVNGTGVCEC
EGGFSGTACETCTEGKYGSNCDQVCGCVHGQCSQGPSGDGSCECDVGWRGVKCDSEIKDD
DCNKTCHTSANCLLSSDGTAYCKCAAGFQGNGTACTGKSIPIDACETSNGGCSGQADCRR
TTPGNRVCVCKAGYTGDGIVCLEINPCLENNGGCDQNAECTQIGPNQAVCNCLRGYTGDG
KTCTLINICLTKNGGCSEFAVCNHTALDERTCTCKPGYKGDGFICRGPIYLELPKNAQTT
PYFIHLQENAIRDLMGSGPFTVFVPFGEAFENASQVKEWTTQGVLPQILRYHVVSCHQLL
LENLKLSPSITSLQGEALQITVSQDTVYLNGKAKIVSSDTICSNGVIHIIDQLLVPKKLQ
AIHKDASGNNMENLTSVAIHQGYLRFSSMLQDAGLLSFINDPIHKPVTLFWPTDKALEAL
PQEQQDFLFSKDNKDKLKDYLKFHIIRDSKILAVDLPGVASRKTLQGSELSVKCGDDNIG
DLLLNDQKCRIVQRQLEFDSGIAYGIDCMLINPSFGGRCDSFITFNVSGDCGSCYNIPRC
PTWSKPKGVKQKCFYHLPFRRNLEGCQQKCTMIMRLPKCCKGYFGRDCQACPGGPRTPCN
NRGICTDEYFGAGECKCNTGFNGTACELCWPGRYGPDCKPCDCSEHGSCDDGITGSGDCF
CETGWTGRFCDSQLALAPVCTPPCSKYATCKENNTCECNLHYEGDGITCTVVDFCKQNNG
GCSKVAKCSQTGTKVTCSCQKGYKGDGHICNAVDPCADGLNGGCHEHAVCTMTGPGKHRC
ECKSHYVGDGLDCVVEQLPIDRCLQDNGQCHADANCADLHFQDATIGVFHLRSPRGQYKL
SFDEAKEMCTKEEATVATYIQLSYAQKAKYHLCSAGWLNDGRVAYPTAYSSQNCGSGFVG
IVDYGPRPNKSELWDVFCYRVKDVNCTCKVGYVGDGFACSGNLLQVLMSFPSLANFLSEV
LVYSNSSSRGKAFLKHLTDLSIQGTLFVPNNDGLWENKTLSGRDIEHHLSNSSTLFYEDL
ANGTTLQTRLGGQLLITYGQDIHHTNETRLVDGQVILQWDIIASNGIIHIISGPLKAPPV
PNVSAHAGLGAGVFFTIILVIGAIALAVYSYFRINRRTIGFQHFEPEEDIDVTSLGKQPS
SNISNPMYESATTPPPPEPAYDPFADSDEQQLVTSSPQEL
Download sequence
Identical sequences F7GLT0
ENSMODP00000002854 ENSMODP00000002854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]