SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002889 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002889
Domain Number 1 Region: 50-375
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.45e-76
Family Pancreatic carboxypeptidases 0.00000138
Further Details:      
 
Domain Number 2 Region: 375-471
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 5.89e-22
Family Carboxypeptidase regulatory domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002889   Gene: ENSMODG00000002373   Transcript: ENSMODT00000002946
Sequence length 476
Comment pep:novel chromosome:BROADO5:5:107295167:107416854:-1 gene:ENSMODG00000002373 transcript:ENSMODT00000002946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRRGGRALLALGAALIACAWLLGSAAAAGEPGAAGMRRRRRLHQEDGISFEYHRYPELR
EALVSVWLQCPSVSKIYTVGRSFEGRDLLVIELSDNPGEHEPGEPEFKYIGNMHGNEAVG
RELLIFLAQYLCNEYQKGNETIINLIHNTRIHIMPSLNPDGFEKAASQPGELKDWFVGRS
NAQGIDLNRNFPDLDRIVYVNEREGGPNNHLLKNLKKIVDQNTKLAPETKAVIHWIMDIP
FVLSANLHGGDLVANYPYDETRSGSAHEYSPCPDDATFQSLARGYSSFNPAMSDPNRPPC
RKNDDDSSFVDGTTNGAAWYSVPGGMQDFNYLSSNCFEITVELSCDKFPPEETLKSYWED
NKNSLINYLEQIHRGVKGFVRDLQGKPIANATISVEGIDHDITTAKDGDYWRLLVPGNYK
LTASAPGYLAITKKVAVPYSPAVGLNFELESLSERKEEEKEELMEWWKMMSETLNF
Download sequence
Identical sequences F7G381
ENSMODP00000002889 13616.ENSMODP00000002889 ENSMODP00000002889 XP_001373907.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]