SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003016 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003016
Domain Number 1 Region: 46-504
Classification Level Classification E-value
Superfamily Cytochrome P450 7.2e-138
Family Cytochrome P450 0.00000000529
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003016   Gene: ENSMODG00000002806   Transcript: ENSMODT00000003081
Sequence length 505
Comment pep:novel chromosome:BROADO5:2:32040672:32070785:1 gene:ENSMODG00000002806 transcript:ENSMODT00000003081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVLELGKMQFPSLWEGASLKSLLLFSAVFLMLASYLQRRRRHPNYPPGPFQLPFLGNFFH
MDHKNPHMAFYQLAKKYGNIFSLELVGCPVIVVTGLSLIKEVLVNQGQVFVDRPHTPLRS
YVFKKLGLIMSNGQEWKDQRRFTLMTLRNFGLGKRTLELRIQEEAMYLTEAIREEKGQPF
DPHFQINNAVSNIICSVTFGNRFEYHDSQFRELLKILDEAMMLQTKWECQFFEMFPRIMK
FLPGAHKKLFREWKKLESFVLDIIRQHKENPNSEEAQDFIEAYLTELSKKYSGNISPSFS
EDNLVSCTLDLFLAGTETTSTTLRWALLYMALCPEIQGKIQAEIDRVVGQSRLPTMADRE
NMPYTNAAVHEIQRMGNIVPFNVPRMSTVDTTVAGYHVPKGTLLVTNLTALHRDPKEWAT
PDAFNPEHFLEDGQFKKRESFLPFSAGKRVCLGEQLARTELFIFFTCLLQRFTFQAPPDT
QLTLDFRIGLTISPAPYKICAIPRE
Download sequence
Identical sequences F7BVU7
ENSMODP00000003016 13616.ENSMODP00000003016 ENSMODP00000003016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]