SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003017 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003017
Domain Number 1 Region: 249-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000144
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 2 Region: 378-427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000642
Family Laminin-type module 0.0087
Further Details:      
 
Domain Number 3 Region: 430-477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000809
Family Laminin-type module 0.0069
Further Details:      
 
Domain Number 4 Region: 315-367
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000264
Family Laminin-type module 0.035
Further Details:      
 
Domain Number 5 Region: 533-580
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000212
Family Laminin-type module 0.034
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000003017
Domain Number - Region: 480-513
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000114
Family Laminin-type module 0.046
Further Details:      
 
Domain Number - Region: 949-1129
Classification Level Classification E-value
Superfamily Tropomyosin 0.00121
Family Tropomyosin 0.014
Further Details:      
 
Domain Number - Region: 77-181
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00451
Family N-terminal domain of xrcc1 0.044
Further Details:      
 
Domain Number - Region: 829-902
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00889
Family Myosin rod fragments 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003017   Gene: ENSMODG00000002485   Transcript: ENSMODT00000003082
Sequence length 1171
Comment pep:novel chromosome:BROADO5:2:116828375:116893891:-1 gene:ENSMODG00000002485 transcript:ENSMODT00000003082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPLLMLMALPGLLHAQQACSRGACYPPVGDLLVGRTRFLKASSTCGITKPETYCTPYGE
WKMKCCKCDSRLPHGYNSHRVENVVSSSGPMRWWQSQNDVSPVSLQLNLDRKFQLQDIKL
DLQGPLPAGMLIERSPDFGKTWKVYQYLAPNCAATFPHLRQGRPQNWQDVRCQPLSAQHT
GPNRGGKVHLNLLDLASGIPASQSQKIRELGEITNLRVNLTTLDPVPQMRFHSPSDYFAV
SHLRLQGSCLCHGHADRCAPLPGTPADPSARVQVHEVCVCQHNTAGPNCDRCAPFYNNQP
WKPADDQNPHECQRCDCNGHSETCHFDPAVFAASQGVSGGVCDNCRDHTEGKNCERCQLH
YFRNRRPGVPIQETCIPCECDPDGAVPGAPCDPLTGQCVCKENVQGERCDLCKPGFTGLT
HANPQGCSRCDCSILGSRRDMPCDEETGRCLCLPNVVGPKCDQCAPHYWKVASGRGCEPC
NCDPRNSYGPQCNQFTGQCPCREGFEGPTCSAMSIRLCPDRTFGDTGTECRACDCDFRGT
EGPGCDKATGRCLCRPGFVGPRCDQCQRGFCDNYPVCVACHPCFQKYDRNLREEAFRLRA
LVNTTAGLRPGSSPGAHGLGPQIVEAENSIRQIQAMLRTPSVTEQEITEVANDIFSVRRM
LQSLRTDLPLEEETDSLSGELENLDRSLKLLLIQYQNKREQFERISSTDPSGSLRMLTSA
YQMSSQAAQRIASSSNLLLQAHDSRREAERLERQVEGSGSAGGPQLQTLRQQMASFPNLT
PTINKICGTTRQDTCTPGQCQGILCPRDNGTTCDPDCRGTLHRAGSAFRTAKQVSQQLQD
FNAQLQQTKQMIRAAEEAATQIQTDAQLLETQVSNSRSQMEEDVRRTRILIQQVRDFLTD
PSTDAATIQEISESVLALWLPTDSATVLRKMNEIQAIAARLPNVDLVLSQTKQDVARARK
LQEEAELARSRAIAVEGQVEDVVGNLRQGTVALQEAEDTMQGTRRSLGLLQDRITEVQQV
LAPTERMVTGMTEQLSSFRDRIEQLRLKVGEQRAQSAQAQKIAQGANEQALSAQQGFERV
KQKYAELKDQMGQSPMLGEQGTRILSVKAEAEELFEETMSMMDRMKAMEAELLLGSQAIT
LRSADLTGLEKHVEKIRDHINKRVLYYATCQ
Download sequence
Identical sequences F7BVU0
ENSMODP00000003017 XP_007481387.1.35504 XP_007481388.1.35504 ENSMODP00000003017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]